Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_069333144.1 C8J29_RS18800 ATP-binding cassette domain-containing protein
Query= TCDB::Q9X272 (328 letters) >NCBI__GCF_003046325.1:WP_069333144.1 Length = 331 Score = 263 bits (672), Expect = 4e-75 Identities = 133/324 (41%), Positives = 203/324 (62%), Gaps = 19/324 (5%) Query: 12 PLLQTVDLKKYFPQGK---------------RILKAVDGISIEIKEGETLGLVGESGCGK 56 P++ +L K FP + R ++AVD +S E+ GET+G+VGESGCGK Sbjct: 5 PMIAAHELSKVFPLERGLWSALSRKLSGRPPRRVQAVDRVSFEVAPGETVGIVGESGCGK 64 Query: 57 STLGRTILKLLRPDGGKIFFEGKDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRI 116 STL + + L +GG++ G+ + + + K+Q+IFQDP SLN +M V I Sbjct: 65 STLAKMLAGLSGTNGGELLLRGRPLAEVMSDPRQAL--KVQMIFQDPQSSLNARMKVVDI 122 Query: 117 IEDPLIIHKIGTKKERRKRVEELLDMVGIGREFINSFPHEFSGGQQQRIGIARALALNPK 176 + + ++H + + E+ RV +L+ VG+G E ++ +PH+FSGGQ+QRIGIARALA+ P+ Sbjct: 123 VGEAPVVHGLIPRAEKEARVRAMLERVGLGPEALHRYPHQFSGGQRQRIGIARALAVEPE 182 Query: 177 FIVCDEPVSALDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIV 236 ++CDE V+ALDVS+QAQII+LL E+++ +G++ LFI+H+L+V+ HI +V VMYLG+ V Sbjct: 183 LLICDESVAALDVSVQAQIINLLMELRRDLGLTMLFISHDLSVIRHICDRVIVMYLGRAV 242 Query: 237 EYGDVDKIFLNPIHPYTRALLKSVPKIPWDGQKQRFYSLKGELPSPIDLPKGCRFQTRCT 296 E D +F +P HPYTR LL +P+I +++ F + GE+PSP+ P GC F RC Sbjct: 243 EIAPTDALFADPRHPYTRMLLAGMPRI--STERRAFLEVAGEIPSPLAPPAGCHFHPRCQ 300 Query: 297 EKKAICFEKEPELTEVEKNHFVSC 320 + C + P L V+ +C Sbjct: 301 FRTEECLAQRPPLDPVDARRSAAC 324 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 331 Length adjustment: 28 Effective length of query: 300 Effective length of database: 303 Effective search space: 90900 Effective search space used: 90900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory