Align Fructokinase; EC 2.7.1.4 (characterized)
to candidate WP_108223429.1 C8J29_RS17465 ribokinase
Query= SwissProt::P26420 (307 letters) >NCBI__GCF_003046325.1:WP_108223429.1 Length = 315 Score = 87.8 bits (216), Expect = 3e-22 Identities = 88/299 (29%), Positives = 127/299 (42%), Gaps = 31/299 (10%) Query: 3 GKIWVLGDAVVDLLP-----DGEGRLLQCP------GGAPANVAVGVARLGGDSGFIGRV 51 G+I V+G +VDL+ G ++ P GG AN AV A+LG + +V Sbjct: 7 GRIAVVGSNMVDLVTYITRMPAPGETIEAPDFEIGCGGKGANQAVAAAKLGSAVSMVTKV 66 Query: 52 GDDPFGRFMRHTLAQEQVDVNYMRLDAAQRTSTVVVDLDSHGERTFTFMVRPSADLFLQP 111 GDD FG R LAQ +D+ ++ A + + + +++ GE + ++ A+ L P Sbjct: 67 GDDIFGENTRRNLAQHGIDIRHVETVAGKSSGVAPIFVEASGEN--SILIVKGANAALLP 124 Query: 112 EDLPPFAAGQWLHVCS-IALSAEPSRSTTFAALEAIKRAGGYVSFDP-NIRSDLWQDPQD 169 D+ AA + L I + E R T + G +P +DL D D Sbjct: 125 ADVD--AAEETLRAADLILMQMEVPRETVIHTVRRAAEWGVRTILNPAPAAADLNVD--D 180 Query: 170 LRDCLDRALALADAIKLSEEELAFIS----GSDDIVSGIARLNARFQPTLLLVTQGKAGV 225 LRD + +E ELA IS GS+D ++ AR ++VT G G Sbjct: 181 LRD--------LSFLVPNESELALISGLPTGSEDEIAAAARSLIERGIGTVIVTLGGRGA 232 Query: 226 QAALRGQVSHFPARPVVAVDTTGAGDAFVAGLLAGLAAHGIPDNLAALAPDLALAQTCG 284 + R V V VDTTGAGDAF+ LAA G + A A A G Sbjct: 233 RLVTRAGVVPIAPVRVTPVDTTGAGDAFIGAFAHFLAATGEVEGALAQAARYAAHSVTG 291 Lambda K H 0.321 0.137 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 315 Length adjustment: 27 Effective length of query: 280 Effective length of database: 288 Effective search space: 80640 Effective search space used: 80640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory