Align MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized)
to candidate WP_069332029.1 C8J29_RS20170 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q00752 (377 letters) >NCBI__GCF_003046325.1:WP_069332029.1 Length = 359 Score = 313 bits (801), Expect = 6e-90 Identities = 181/371 (48%), Positives = 229/371 (61%), Gaps = 23/371 (6%) Query: 1 MVELNLNHIYKKYPNSSHYSVEDFDLDIKNKEFIVFVGPSGCGKSTTLRMVAGLEDITKG 60 M ++L I K+Y ++ DL++++ EF+ FVGPSGCGKST LRM+AGLEDI+ G Sbjct: 1 MARISLQKIVKRYGGME--AIHGVDLEVEDGEFVAFVGPSGCGKSTMLRMIAGLEDISGG 58 Query: 61 ELKIDGEVVNDKAPKDRDIAMVFQNYALYPHMSVYDNMAFGLKLRHYSKEAIDKRVKEAA 120 ++I +VND PK RD+AMVFQ+YALYPHM+V DN+ FGLK+R E I K+V+EAA Sbjct: 59 HMRIGDRLVNDIEPKGRDVAMVFQDYALYPHMTVRDNIGFGLKMRGEPAETIRKKVEEAA 118 Query: 121 QILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVSMRAEIAK 180 +IL L + L+R+P LSGGQRQRVAMGRAIVR KVFL DEPLSNLDAKLRV MR +I + Sbjct: 119 RILQLEDLLDRRPGQLSGGQRQRVAMGRAIVRKPKVFLFDEPLSNLDAKLRVEMRTQIKR 178 Query: 181 IHRRIGATTIYVTHDQTEAMTLADRIVIMSSTKNEDGSGTIGRVEQVGTPQELYNRPANK 240 +HR + TTIYVTHDQ EAMTLADR+V++ G + Q G P ELY RP+ + Sbjct: 179 LHRMLRTTTIYVTHDQVEAMTLADRVVVLRK----------GSIIQHGRPLELYERPSCR 228 Query: 241 FVAGFIGSPAMNFFDVTIKDGHLVSKD-GLTIAVTEGQLKMLESKGFKNKNLIFGIRPED 299 FVA FIGSP MN I G + S D G I V G + + + G+RPE Sbjct: 229 FVAEFIGSPQMN-----ILPGRVASSDRGTVIEVGGGAISLSHLPVPVGTAVDVGLRPEH 283 Query: 300 ISSSLLVQETYPDATVDAEVVVSELLGSETMLYLKLGQTEFAARVDARDFHEPGEKVSLT 359 + +A AEV V E LGS+T+ +G+ E RV A G L Sbjct: 284 LEPC-----APEEADFVAEVDVLEELGSDTLAICLMGEREITVRVPADRARSLGRAQPLR 338 Query: 360 FNVAKGHFFDA 370 F+ H FDA Sbjct: 339 FDRQNLHLFDA 349 Lambda K H 0.318 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 359 Length adjustment: 30 Effective length of query: 347 Effective length of database: 329 Effective search space: 114163 Effective search space used: 114163 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory