Align Beta-phosphoglucomutase; Beta-PGM; EC 5.4.2.6 (characterized)
to candidate WP_069333390.1 C8J29_RS07065 HAD family hydrolase
Query= SwissProt::P77366 (219 letters) >NCBI__GCF_003046325.1:WP_069333390.1 Length = 228 Score = 52.4 bits (124), Expect = 7e-12 Identities = 59/191 (30%), Positives = 83/191 (43%), Gaps = 27/191 (14%) Query: 6 VIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQF-NESLKGISRDESLRRILQHGGKE- 63 VIFD DGV+ D+ L G +D F + G S + + G Sbjct: 6 VIFDCDGVLVDSEVLAVAVLIAELDRAGARVDEAFVHRHFLGRSFPVVQEVVQRQFGVTL 65 Query: 64 -GDFNSQERAQLAYRKNLLYVHSLRELTVNAVLPGIRSLLADLRAQQISVGLASVSLNAP 122 F ++ERA+L + LR + PG + RA + LA+ S A Sbjct: 66 PETFQTEERARLL----AAFETGLRPM------PGAAETV---RALAVPFCLATSSTPAR 112 Query: 123 -------TILAALELREFFTFCADASQLKNSKPDPEIFLAACAGLGVPPQACIGIEDAQA 175 T LAAL F C ASQ+ KP P++FL A A +GV P+ C+ IED + Sbjct: 113 LTRSLEITGLAAL----FEGRCFTASQVARGKPAPDLFLLAAAEMGVAPERCLVIEDTEP 168 Query: 176 GIDAINASGMR 186 G+ A A+GM+ Sbjct: 169 GVRAGLAAGMQ 179 Lambda K H 0.320 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 228 Length adjustment: 22 Effective length of query: 197 Effective length of database: 206 Effective search space: 40582 Effective search space used: 40582 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory