Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate WP_069332620.1 C8J29_RS03220 D-glycerate dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >NCBI__GCF_003046325.1:WP_069332620.1 Length = 328 Score = 271 bits (693), Expect = 2e-77 Identities = 148/325 (45%), Positives = 211/325 (64%), Gaps = 7/325 (2%) Query: 5 VFITRQIPENGIKMIEKFYEIELWKDPKAPPRGVLLEKVREVDALVTLVTDKVDKELLEN 64 V +TR++P+ +++ +++EL R L+E + D LV +TD +D +L Sbjct: 8 VVVTRRLPDVVEARMKELFQVELRDPDTQMSREDLIEAMGRADVLVPCLTDDIDANMLAQ 67 Query: 65 A-PKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIVEAD 123 A PKLK+IA Y G D+ID+ A +RGI V+NTP V+T+ TAD+A AL+L+V RRI E Sbjct: 68 AGPKLKLIANYGAGVDHIDVASARQRGILVSNTPDVVTEDTADMALALILSVTRRIPEGL 127 Query: 124 AFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKRAKGFGMKIIYYSRTR 183 A ++SG+W GW P+ LG L+G+ LGI+G GRIGQA+A+RA+ FGM+I Y++R R Sbjct: 128 AEMQSGDWP----GWSPMAHLGGRLRGRRLGILGMGRIGQAVARRARAFGMQIHYHNRKR 183 Query: 184 -KPEAEEEIGAEYVD-FETLLKESDFISLHVPLTKETYHMIGEKELKLMKPNAILINTSR 241 +PE E E+GA + + + ++ D IS++ P T T+H++ + LKL+KP A+++NTSR Sbjct: 184 LRPEIEAEVGATFWESLDQMVTRMDIISVNCPHTPSTFHLLNARRLKLLKPTAVIVNTSR 243 Query: 242 GAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEELFKLKNVVLAPHIGSATHEAREGMA 301 G V+D NAL + L+ G IAGAGLDVFE N L +L NVVL PH+GSAT E R M Sbjct: 244 GEVIDENALTRGLRAGEIAGAGLDVFEHGHEINPRLRELPNVVLLPHMGSATLEGRIEMG 303 Query: 302 ELVAKNLIAFAKGEIPPNLVNKDVL 326 E V N+ FA G PP+ V +L Sbjct: 304 EKVILNIKTFADGHRPPDQVLPSML 328 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 328 Length adjustment: 28 Effective length of query: 303 Effective length of database: 300 Effective search space: 90900 Effective search space used: 90900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory