Protein WP_108402258.1 in Limnohabitans curvus MWH-C5

Annotation: NCBI__GCF_003063475.1:WP_108402258.1

Length: 245 amino acids

Source: GCF_003063475.1 in NCBI

Candidate for 29 steps in catabolism of small carbon sources

Pathway	Step	Score	Similar to	Id.	Cov.	Bits	Other hit	Other id.	Other bits
L-asparagine catabolism	aatP	hi	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)	76%	100%	373.2	uncharacterized amino-acid ABC transporter ATP-binding protein yhdZ	58%	279.3
L-aspartate catabolism	aatP	hi	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)	76%	100%	373.2	uncharacterized amino-acid ABC transporter ATP-binding protein yhdZ	58%	279.3
L-glutamate catabolism	gltL	hi	ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized)	76%	100%	371.7	uncharacterized amino-acid ABC transporter ATP-binding protein yhdZ	58%	279.3
L-asparagine catabolism	bztD	med	BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)	55%	92%	268.9	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-aspartate catabolism	bztD	med	BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)	55%	92%	268.9	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
D-alanine catabolism	Pf6N2E2_5405	med	ABC transporter for D-Alanine, ATPase component (characterized)	56%	94%	268.1	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-histidine catabolism	aapP	med	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized)	57%	93%	262.7	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-lysine catabolism	hisP	med	Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)	56%	92%	262.3	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-asparagine catabolism	aapP	med	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	54%	93%	257.7	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-aspartate catabolism	aapP	med	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	54%	93%	257.7	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-glutamate catabolism	aapP	med	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	54%	93%	257.7	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-leucine catabolism	aapP	med	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	54%	93%	257.7	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-proline catabolism	aapP	med	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	54%	93%	257.7	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-asparagine catabolism	glnQ	med	Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized)	54%	97%	255.4	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-asparagine catabolism	bgtA	med	ATPase (characterized, see rationale)	54%	92%	248.8	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-aspartate catabolism	bgtA	med	ATPase (characterized, see rationale)	54%	92%	248.8	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-arginine catabolism	artP	med	Arginine transport ATP-binding protein ArtM (characterized)	52%	100%	235.3	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-asparagine catabolism	peb1C	med	PEB1C, component of Uptake system for glutamate and aspartate (characterized)	49%	100%	227.6	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-aspartate catabolism	peb1C	med	PEB1C, component of Uptake system for glutamate and aspartate (characterized)	49%	100%	227.6	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
D-glucosamine (chitosamine) catabolism	AO353_21725	med	ABC transporter for D-Glucosamine, putative ATPase component (characterized)	49%	94%	227.3	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-histidine catabolism	bgtA	med	BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)	50%	96%	221.5	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-histidine catabolism	hisP	med	Histidine transport ATP-binding protein HisP (characterized)	48%	97%	209.9	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-citrulline catabolism	PS417_17605	med	ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)	46%	90%	208.8	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-citrulline catabolism	AO353_03040	med	ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)	45%	98%	204.5	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-histidine catabolism	BPHYT_RS24015	med	ABC transporter related (characterized, see rationale)	44%	96%	194.5	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-histidine catabolism	PA5503	med	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)	40%	72%	164.1	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-histidine catabolism	hutV	lo	HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)	39%	78%	145.2	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
L-proline catabolism	hutV	lo	HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)	39%	78%	145.2	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2
D-mannose catabolism	TM1749	lo	TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)	33%	80%	113.6	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component	76%	373.2

Sequence Analysis Tools

View WP_108402258.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MIELKNVSKWYGPVQVLNNCSTSIKKGEVVVVCGPSGSGKSTLIKTINALEPFQQGEIFV
DGIAVHGKDTNLPKLRSRVGMVFQHFELFPHLSVTENLTIAQQKVLGRSEEEAHAHGLKY
LERVGLMAHKDKFPGQLSGGQQQRVAIARALSMDPIVMLFDEPTSALDPEMVGEVLDVMV
DLANEGMTMMCVTHEMGFARKVGSRVIFMDVGGKILEDCSKDEFFNHPENRQPRTKEFLN
KILAH

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.