Align trans-2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_108358865.1 B9Z44_RS01345 2-ketocyclohexanecarboxyl-CoA hydrolase
Query= reanno::BFirm:BPHYT_RS17335 (258 letters) >NCBI__GCF_003063475.1:WP_108358865.1 Length = 260 Score = 122 bits (306), Expect = 7e-33 Identities = 87/268 (32%), Positives = 130/268 (48%), Gaps = 24/268 (8%) Query: 1 MAYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALREFDADDAIGAIVVTGS-EK 59 M +E+IL E R V +T+NR +NA DE+ AL + D ++GAIV+ G+ ++ Sbjct: 1 MQFEDILYENRNGVAWITINRADKMNAFRGTTCDEIIKALNKAGYDRSVGAIVLAGAGDR 60 Query: 60 AFAAGADIGMMSTYTYMDVYKGDYITRNW---------ETVRSIRKPIIAAVAGFALGGG 110 AF G D + G+Y R +R + KP+IA V GFA+GGG Sbjct: 61 AFCTGGD---------QSAHDGNYDGRGTIGLPMEELHTAIRDVPKPVIARVQGFAIGGG 111 Query: 111 CELAMMCDIIFAADTAKFGQPEIKLGIMPGAGGTQRLPRAVSKAKAMDLCLTARFMDAAE 170 L +CD+ +D A FGQ K+G + GT L R V + KA ++ R AE Sbjct: 112 NVLCTICDLTICSDKAVFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYLNRRYTGAE 171 Query: 171 AERAGLVSRVIPAASLVDEAIAAAATIAEFPSPAVMMVKESVN--RAYETTLAEGVHFER 228 A GL + +P L E I E A+ + K S N A+++ +A + Sbjct: 172 AVAMGLANVCVPHDQLDAEVQKWGEEICERSPTALAIAKRSFNADTAHQSGIAGLGMYAL 231 Query: 229 RLFHSLFATEDQKEGMAAFVEKRKPVFK 256 +L++ TE+ +EG+ A EKRKP F+ Sbjct: 232 KLYYD---TEESREGVNALKEKRKPEFR 256 Lambda K H 0.321 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 260 Length adjustment: 24 Effective length of query: 234 Effective length of database: 236 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory