Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_108402082.1 B9Z44_RS07505 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_003063475.1:WP_108402082.1 Length = 272 Score = 188 bits (477), Expect = 1e-52 Identities = 95/248 (38%), Positives = 156/248 (62%), Gaps = 4/248 (1%) Query: 1 MGILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSV 60 M +L V+++ K FGG QA++DV+ S++ + A+IGPNGAGKST N + G+L PD+GS+ Sbjct: 1 MTLLSVQHLHKAFGGNQAVNDVSFSLQAGELLALIGPNGAGKSTTFNLVNGQLAPDSGSI 60 Query: 61 MFDGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVS 120 DG S+LGR P+++ +MG+SR FQ + FG L+V+EN+ + + + +A Sbjct: 61 TLDGVSLLGRKPHDLWRMGVSRTFQIAQTFGSLTVIENVQMALLSSDGQSLSPWRRAANY 120 Query: 121 GQRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMA 180 + D L H+LE++ + + +++ GD +RLE+ M L+ EPRLLL+DEPTAGMA Sbjct: 121 RRADAL----HLLEQVQLDTQAQRAGRALAYGDVKRLELAMALANEPRLLLMDEPTAGMA 176 Query: 181 RADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNP 240 + + ++L + + ++R + + EH M VVF ADR+ V+A+G + + P ++ +P Sbjct: 177 PDERHALMNLTRSLVTQRGVAVLFTEHSMDVVFEHADRVLVMARGALIAQGTPAQVQADP 236 Query: 241 KVREAYLG 248 V+ Y G Sbjct: 237 HVQTVYFG 244 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 272 Length adjustment: 25 Effective length of query: 226 Effective length of database: 247 Effective search space: 55822 Effective search space used: 55822 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory