Align 4-(gamma-glutamylamino)butanal dehydrogenase (EC 1.2.1.99) (characterized)
to candidate WP_108402347.1 B9Z44_RS09990 aldehyde dehydrogenase family protein
Query= BRENDA::P23883 (495 letters) >NCBI__GCF_003063475.1:WP_108402347.1 Length = 485 Score = 273 bits (699), Expect = 8e-78 Identities = 177/473 (37%), Positives = 260/473 (54%), Gaps = 10/473 (2%) Query: 24 INGEYTAAAENETFETVDPVTQAPLAKIARGKSVDIDRAMSAARGVFERGDWSLSSPAKR 83 I+ E+ A + ++V+P + + A D + A++AAR FER DW+ SP R Sbjct: 9 IDNEWQPAQSGQFEDSVNPADGRVIGRYAASDGADAEAAIAAARRAFERPDWA-QSPRLR 67 Query: 84 KAVLNKLADLMEAHAEELALLETLDTGKPIRHSLRDDIPGAARAIRWYAEAIDKVYGEVA 143 + V+ K AD +EAHA+ELA L TL+ GK + S R ++ GA IR+YA + G V Sbjct: 68 QMVMLKWADRLEAHADELAHLLTLENGKVLAQS-RGEMAGAISEIRYYAGLTRFIPGHVF 126 Query: 144 TTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGPALAAGNSVILKPSEKSPL-SAIR 202 + +++EP GV IVPWN P++L + PALAAG + ++KP+ ++ L +A Sbjct: 127 EVEPGAYSTLLKEPAGVAGIIVPWNAPVVLLIRSITPALAAGCTTVIKPAPQTALITAAV 186 Query: 203 LAGLAKEAGLPDGVLNVVTGFGHEAGQALSRHNDIDAIAFTGSTRTGKQLLKDAGDSNMK 262 LA L A LP GVLN+V+ GH QAL+ D+D I+FTGS TG++++ A + MK Sbjct: 187 LADLQAVAELPRGVLNLVSECGHAVAQALTTSADVDVISFTGSNATGQRIMAAAAPT-MK 245 Query: 263 RVWLEAGGKSANIVFADCPDLQQAASATAAGIFYNQGQVCIAGTRLLLEESIADEFLALL 322 ++ LE GGKS +VF D D+ + A AA GQ C A R+L+ S DE L Sbjct: 246 KLSLELGGKSCCLVFDDV-DVSRIAPQLAAAATIISGQQCTAARRVLVHASRYDEMKVAL 304 Query: 323 KQQAQNWQPGHPLDPATTMGTLIDCAHADSVHSFIREGESKGQ--LLLDGRNAGLAAA-- 378 Q Q L +G LID V I + +L GR GL+A+ Sbjct: 305 SQALQALVVAPGLAAGAQLGPLIDAPSHQRVSQAIAQATDLADEVILRGGRPDGLSASGH 364 Query: 379 -IGPTIFVDVDPNASLSREEIFGPVLVVTRFTSEEQALQLANDSQYGLGAAVWTRDLSRA 437 + PT+ D +A ++EIFGP +V+ +F E+ A++ AN S YGL A+VWT+D +R Sbjct: 365 FMTPTLVAHRDTSAFFVQDEIFGPFVVLEKFEDEQDAVKRANHSDYGLSASVWTQDGARQ 424 Query: 438 HRMSRRLKAGSVFVNNYNDGDMTVPFGGYKQSGNGRDKSLHALEKFTELKTIW 490 R++R L+ G+V++N +N GGY++SG GR AL F E+K I+ Sbjct: 425 MRVARALRNGTVWLNEHNKLFAEAETGGYRRSGLGRLHGYDALIDFMEIKHIY 477 Lambda K H 0.317 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 542 Number of extensions: 31 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 485 Length adjustment: 34 Effective length of query: 461 Effective length of database: 451 Effective search space: 207911 Effective search space used: 207911 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory