Align N-succinylglutamate 5-semialdehyde dehydrogenase; EC 1.2.1.71; Succinylglutamic semialdehyde dehydrogenase; SGSD (uncharacterized)
to candidate WP_108402347.1 B9Z44_RS09990 aldehyde dehydrogenase family protein
Query= curated2:B0T8I8 (484 letters) >NCBI__GCF_003063475.1:WP_108402347.1 Length = 485 Score = 157 bits (396), Expect = 1e-42 Identities = 154/471 (32%), Positives = 230/471 (48%), Gaps = 34/471 (7%) Query: 7 IDGVWR-AGAGAQATSVDPTTGEVIWRQATASTAEVAAAVEAARKAF--PAWADRSREER 63 ID W+ A +G SV+P G VI R A + A+ AA+ AAR+AF P WA R + Sbjct: 9 IDNEWQPAQSGQFEDSVNPADGRVIGRYAASDGADAEAAIAAARRAFERPDWAQSPRLRQ 68 Query: 64 IAVLRRYKDVLVARTGTFAEALSRETGKALWETKAELGSMAGKVEASIKAYDERTG---E 120 + +L+ + D L A A L+ E GK L +++ G MAG + + I+ Y T Sbjct: 69 MVMLK-WADRLEAHADELAHLLTLENGKVLAQSR---GEMAGAI-SEIRYYAGLTRFIPG 123 Query: 121 HANDMAFGR-AVLRHRAHGVMAVLGPFNFPGHLPNGHIVPALLAGDTVVFKPSEETPL-A 178 H ++ G + L GV ++ P+N P L I PAL AG T V KP+ +T L Sbjct: 124 HVFEVEPGAYSTLLKEPAGVAGIIVPWNAPVVLLIRSITPALAAGCTTVIKPAPQTALIT 183 Query: 179 GQLLVEALEEAGVPAGVINLV-QGGREVGQALIDQ-EIDGLLFTGSAAAGAFFRRHFADR 236 +L + A +P GV+NLV + G V QAL ++D + FTGS A G R A Sbjct: 184 AAVLADLQAVAELPRGVLNLVSECGHAVAQALTTSADVDVISFTGSNATGQ--RIMAAAA 241 Query: 237 PDVI-LALELGGNNPLVVWDAGDPEAVAALIVQSAFITTGQRCSCARRLIVSDDAAGRAV 295 P + L+LELGG + +V+D D +A + +A I +GQ+C+ ARR++V Sbjct: 242 PTMKKLSLELGGKSCCLVFDDVDVSRIAPQLAAAATIISGQQCTAARRVLVHASRYDEMK 301 Query: 296 IDAVAALSERLVIGPW--NGGQEPFMGPLI---SDRAAAMALAGAKAMPGQTLRAMTSVD 350 + A++ + LV+ P G Q +GPLI S + + A+A A + + + D Sbjct: 302 V-ALSQALQALVVAPGLAAGAQ---LGPLIDAPSHQRVSQAIAQATDLADEVILRGGRPD 357 Query: 351 GLSRA--FVSPGLV---DVTGETVPDEELFAPLLQVRRVGSFEEAIAAANATRYGLSAGL 405 GLS + F++P LV D + V D E+F P + + + ++A+ AN + YGLSA + Sbjct: 358 GLSASGHFMTPTLVAHRDTSAFFVQD-EIFGPFVVLEKFEDEQDAVKRANHSDYGLSASV 416 Query: 406 VSNETAHWDRFLTRIRAGVVNWNRPTTGAAGTMPFGGLGNSGNHRPSAYYA 456 + + A R +R G V W GG SG R Y A Sbjct: 417 WTQDGARQMRVARALRNGTV-WLNEHNKLFAEAETGGYRRSGLGRLHGYDA 466 Lambda K H 0.318 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 548 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 484 Length of database: 485 Length adjustment: 34 Effective length of query: 450 Effective length of database: 451 Effective search space: 202950 Effective search space used: 202950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory