Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate WP_108358576.1 B9Z44_RS13765 ABC transporter ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >NCBI__GCF_003063475.1:WP_108358576.1 Length = 234 Score = 141 bits (355), Expect = 2e-38 Identities = 77/213 (36%), Positives = 124/213 (58%), Gaps = 5/213 (2%) Query: 9 KTYRVAGREIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVEGED 68 K+ + A + L+ ++ Q ++G SG+GKSTLL ++ L+ P+ G + + G D Sbjct: 24 KSVQDASGTLHILRDIDFHLAPQQSLAIVGASGSGKSTLLSIMAGLDTPTQGTVWLGGMD 83 Query: 69 VTALDAEGLRRFRQR-VGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDARVSELLA 127 + A+D + R R VG +FQ F LL + T +N+ +PL LAG A ++L Sbjct: 84 MFAMDEDARAAVRARQVGFVFQSFQLLGNMTALENVMLPLELAG---LPNPRAAAKDMLV 140 Query: 128 RVGLSDHARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTASVLQLLAEI 187 RVGL + YP LSGG++QRV +ARA +P++LL DE T +LD + ++ L+ E+ Sbjct: 141 RVGLGERLGHYPKVLSGGEQQRVALARAFVVKPALLLADEPTGSLDHASGERIMDLMFEL 200 Query: 188 NRELKLTIVLITHEMDVIRRVCDQVAVMDGGAI 220 N+EL T+VL+TH++ + R CDQ ++ G + Sbjct: 201 NKELGTTLVLVTHDLKLAAR-CDQAITIEAGQV 232 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 234 Length adjustment: 26 Effective length of query: 309 Effective length of database: 208 Effective search space: 64272 Effective search space used: 64272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory