Align predicted cytochrome c component of periplasmic glucoside 3-dehydrogenase (EC 1.1.99.13) (characterized)
to candidate WP_108401730.1 B9Z44_RS03615 c-type cytochrome
Query= reanno::Pedo557:CA265_RS15360 (127 letters) >NCBI__GCF_003063475.1:WP_108401730.1 Length = 101 Score = 68.6 bits (166), Expect = 2e-17 Identities = 33/76 (43%), Positives = 44/76 (57%) Query: 49 LINKSDCLGCHNKTNKIIGPAYVEIAKKYPATEKNINMLADKIIKGGTGVWGNMPMTAHA 108 L K++CL CH KI+GPAY ++AKKY LA I GG+G WG +PM A A Sbjct: 23 LAKKNNCLSCHAIDKKIVGPAYQDVAKKYAGQADAEAALAKSIKAGGSGKWGPIPMPAQA 82 Query: 109 TLKKDDAKLMVKYILS 124 L DAK + ++L+ Sbjct: 83 QLSDADAKALAAWVLA 98 Lambda K H 0.317 0.131 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 57 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 127 Length of database: 101 Length adjustment: 12 Effective length of query: 115 Effective length of database: 89 Effective search space: 10235 Effective search space used: 10235 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 40 (20.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory