Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Allergen Cla h 8; EC 1.1.1.138 (characterized)
to candidate WP_108358580.1 B9Z44_RS13785 3-oxoacyl-ACP reductase FabG
Query= SwissProt::P0C0Y5 (267 letters) >NCBI__GCF_003063475.1:WP_108358580.1 Length = 255 Score = 123 bits (309), Expect = 3e-33 Identities = 80/260 (30%), Positives = 136/260 (52%), Gaps = 9/260 (3%) Query: 7 TKHESLLDQLSLKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKE 66 T H S +L +GKV ++TGA+ +G+G+ A A GA V + +A +E VK+ Sbjct: 3 TNHNSQAQRL--QGKVSLITGAA--QGIGLATALKFAREGAIVIVCDVKQA-AVDEAVKQ 57 Query: 67 LEKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWN 126 + G +A + V + + VK V+ FG+ID + NAG T D+ + ++E ++ Sbjct: 58 CQ-ALGAQALGFVVDVTQRDMVDATVKAVLDKFGRIDVLVNNAGITQDARLQKMTLEQFD 116 Query: 127 HVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIANFPQEQTSYNVAKAGCIHMA 186 V+ V+L G FHCA+AV +G+G ++ +S+ G NF QT+Y K G I Sbjct: 117 RVIDVNLRGVFHCAQAVTEAMVAQGSGVILNASSVVGIYGNF--GQTNYAATKFGVIGFT 174 Query: 187 RSLANEWRDFA-RVNSISPGYIDTGLSDFVPKETQQLWHSMIPMGRDGLAKELKGAYVYF 245 ++ + E RVN+++PG+I T + +P++ +P+ R G +++ Y + Sbjct: 175 KTWSRELGPKGIRVNAVAPGFIQTPILSTIPEKVIHEMTDRVPLKRLGQPEDIANVYAFL 234 Query: 246 ASDASTYTTGADLLIDGGYT 265 ASD + Y G + + GG T Sbjct: 235 ASDEAAYINGTVIEVAGGLT 254 Lambda K H 0.316 0.131 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 255 Length adjustment: 25 Effective length of query: 242 Effective length of database: 230 Effective search space: 55660 Effective search space used: 55660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory