Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate WP_108402515.1 B9Z44_RS11745 NAD-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::P77674 (474 letters) >NCBI__GCF_003063475.1:WP_108402515.1 Length = 492 Score = 301 bits (770), Expect = 4e-86 Identities = 177/469 (37%), Positives = 264/469 (56%), Gaps = 9/469 (1%) Query: 6 LINGELVSGEGEKQPVYNPATGDVLLEIAEASAEQVDAAVRAADAAFAEWGQTTPKVRAE 65 LING V G + V++PATG L ++A AA+ AA+AA+ W T K R+ Sbjct: 22 LINGHWVKG-ASRFDVHDPATGKKLADVANLGPADASAAIDAANAAWPAWRNKTGKERSI 80 Query: 66 CLLKLADVIEENGQVFAELESRNCGKPLHSAFNDEIPAIVDVFRFFAGAARCLNGLAAGE 125 L K D++ + + + + GKP A E+ +FA A+ +NG + Sbjct: 81 ILRKWFDLLMAHQEDLGRIMTAEQGKPFAEA-KGEVVYGASFVEWFAEEAKRVNGETLPQ 139 Query: 126 YLEGHTSMIRRDPLGVVASIAPWNYPLMMAAWKLAPALAAGNCVVLKPSEITPLTALKLA 185 + M+ + P+GV A+I PWN+PL M K+APALAAG VV+KP+E+ PLTAL A Sbjct: 140 FDNNRRLMVLKQPIGVCAAITPWNFPLAMITRKVAPALAAGCPVVIKPAELPPLTALAAA 199 Query: 186 ELA-KDIFPAGVINILFGRGKT---VGDPLTGHPKVRMVSLTGSIATGEHIISHTASSIK 241 ELA + P GV+NIL +G VR +S TGS G +++ +A SIK Sbjct: 200 ELAIRAGIPDGVLNILTADSDNSIAIGKVFCSSDIVRHISFTGSTEVGRILMAQSAPSIK 259 Query: 242 RTHMELGGKAPVIVFDDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVEKLG 301 + +ELGG AP IVFDDADI++ VEG Y NAGQ C A RIY Q +YD V+K Sbjct: 260 KLALELGGNAPFIVFDDADIDSAVEGAMASKYRNAGQTCVCANRIYVQDAVYDEFVQKFA 319 Query: 302 AAVATLKSGAPDDESTELGPLSSLAHLERVGKAVEEAKATGHIKVITGGEKRKGNGYYYA 361 A V LK G ++ GPL A +++V + V++A G K+ITGG K G ++ Sbjct: 320 AKVKALKVGNGFEDGVTQGPLIEDAAVDKVERHVQDALHKGG-KLITGGHKL--TGQFFE 376 Query: 362 PTLLAGALQDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLASSVWTKDVGRAHRV 421 PT++A A D ++E FGP V F +++ ++ AN++++GLAS +++D+GR +RV Sbjct: 377 PTVIADARADMLCAREETFGPFAPVFRFHKDQEAIDAANNTEFGLASYFYSRDIGRIYRV 436 Query: 422 SARLQYGCTWVNTHFMLVSEMPHGGQKLSGYGKDMSLYGLEDYTVVRHV 470 S L+YG +N + +P GG K SG G++ S +G+++Y ++++ Sbjct: 437 SEALEYGMVGINVGIIASEHVPFGGVKQSGLGREGSSHGMDEYVEMKYL 485 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 568 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 474 Length of database: 492 Length adjustment: 34 Effective length of query: 440 Effective length of database: 458 Effective search space: 201520 Effective search space used: 201520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory