Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_108360123.1 B9Z44_RS13000 D-glycerate dehydrogenase
Query= BRENDA::A0A0M3KL04 (335 letters) >NCBI__GCF_003063475.1:WP_108360123.1 Length = 324 Score = 117 bits (294), Expect = 3e-31 Identities = 94/284 (33%), Positives = 133/284 (46%), Gaps = 22/284 (7%) Query: 57 SNPAVYETLQK-NGLRQLTSRTAGYDMIDLEQASERGLVVTNVPAYSPNSVAELA---LT 112 S+P E L+ L+ + + GY+ D+ + G+ +N P + A+ L Sbjct: 54 SDPVDAEVLKACPNLKAVANMAVGYNNFDVPAMTAHGVQASNTPDVLTETTADFGFALLM 113 Query: 113 QTMRLIRNLPLFDARGAEQDFRWAGLMAREIRSLTVGIIGAGRIG-GTVARLFKALGATV 171 T R I + RG +R+ E+ T+GI+G GRIG G R G V Sbjct: 114 ATARRITESEHYLRRGEWTQWRYDMFAGAEVHGSTIGILGMGRIGQGIARRAAHGFGMKV 173 Query: 172 IAND---IVERVELKDIVTYVSKEELLQAADVVTLHVPLMDSTTQLIDADALALMKNDAV 228 I ++ + E + TYVSKEELL+ AD V L VP ++ I A LA MK A Sbjct: 174 IYHNRSRLSAESEAECKATYVSKEELLKTADHVMLVVPYSAASHHTIGAAELAQMKPTAT 233 Query: 229 LINASRGPVVDTDALIAALQNKQIAGAALDTLNGEEHFFNQDLCGKELPSEQLKVLRTLP 288 LIN +RG +VD AL AL+ KQIA A LD GE K P L T+P Sbjct: 234 LINIARGGIVDDAALAVALREKQIAAAGLDVFEGEP---------KVHPD-----LLTVP 279 Query: 289 NVLITPHIGFYTNKAVQNMVEISLNDVLAILKTGTSEHQLNKVA 332 NV++TPHI + M ++ +++++ G S LN VA Sbjct: 280 NVVLTPHIASASIPTRMAMANLAADNLISYFTQGKSLTPLNTVA 323 Lambda K H 0.317 0.133 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 324 Length adjustment: 28 Effective length of query: 307 Effective length of database: 296 Effective search space: 90872 Effective search space used: 90872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory