Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 2/3) (EC 1.3.1.110) (characterized)
to candidate WP_108401499.1 B9Z44_RS01310 electron transfer flavoprotein subunit alpha
Query= BRENDA::H6LBB1 (418 letters) >NCBI__GCF_003063475.1:WP_108401499.1 Length = 310 Score = 127 bits (318), Expect = 6e-34 Identities = 98/319 (30%), Positives = 160/319 (50%), Gaps = 15/319 (4%) Query: 76 VYVDHIEGQIHPVTFELIGKARELAAVIGHPVYALLMGTNITEKADELLKY-GVDKVFVY 134 V +H I T + A +G V+ L+ G N A + GV KV Sbjct: 5 VIAEHDSASIKGATLNTV----TAAVAMGAEVHVLVAGHNAGAAAAAAAQIAGVSKVIHA 60 Query: 135 DKPELKHFVIEPYANVLEDFIEKVKPSSILVGATNVGRSLAPRVAARYRTGLTADCTILE 194 D L+ + E A + + IL AT G+++APRVAA+ G +D T ++ Sbjct: 61 DGATLEAGLAENVAAQVLAIAGNY--THILFPATAAGKNVAPRVAAKLDVGQISDITKVD 118 Query: 195 MKENTDLVQIRPAFGGNIMAQIVTENTRPQFCTVRYKVFTAPERVNEPWGDVEMMDIEKA 254 + + RP + GN +A + + + + TVR F A +E Sbjct: 119 SPDTFE----RPIYAGNAIATVQSSDA-VKVITVRTTGFDAAAATGGA-AQIETTAATSD 172 Query: 255 KLVSAIEVMEVIKKEKGIDLSEAETIVAVGRGV-KCEKDLDMIHEFAEKIGATVACTRPG 313 S+ EV K ++ +L+ A+ IV+ GR + EK +++ A+K+GA + +R Sbjct: 173 SGKSSFVGREVTKSDRP-ELTAAKIIVSGGRALGSSEKFDEVMTPLADKLGAAIGASRAA 231 Query: 314 IEAGWFDARLQIGLSGRTVKPKLIIALGISGAVQFAAGMQNSEYIIAINSDPKAPIFNIA 373 ++AG+ LQ+G +G+ V P+L +A GISGA+Q AGM++S+ I+AIN DP+APIF++A Sbjct: 232 VDAGYAANDLQVGQTGKIVAPQLYVACGISGAIQHLAGMKDSKVIVAINKDPEAPIFSVA 291 Query: 374 HCGMVGDLYEILPELLTMI 392 G+ DL+ +PEL+ + Sbjct: 292 DFGLEADLFVAVPELVAAL 310 Lambda K H 0.319 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 310 Length adjustment: 29 Effective length of query: 389 Effective length of database: 281 Effective search space: 109309 Effective search space used: 109309 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory