Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate WP_108358865.1 B9Z44_RS01345 2-ketocyclohexanecarboxyl-CoA hydrolase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2986 (356 letters) >NCBI__GCF_003063475.1:WP_108358865.1 Length = 260 Score = 76.3 bits (186), Expect = 8e-19 Identities = 51/154 (33%), Positives = 76/154 (49%), Gaps = 4/154 (2%) Query: 7 EVLAEVRNHIGHLTLNRPAGLNALTLDMVRNLHRQLDAWAQDSQVHAVVLRGAGEKAFCA 66 ++L E RN + +T+NR +NA + + L+ D V A+VL GAG++AFC Sbjct: 5 DILYENRNGVAWITINRADKMNAFRGTTCDEIIKALNKAGYDRSVGAIVLAGAGDRAFCT 64 Query: 67 GGDIRSLHDSFKSGDTLHEDFFVEEYALDLAIHHYRKPVLALMDGFVLGGGMGLVQGADL 126 GGD +S HD G + L AI KPV+A + GF +GGG L DL Sbjct: 65 GGD-QSAHDGNYDG---RGTIGLPMEELHTAIRDVPKPVIARVQGFAIGGGNVLCTICDL 120 Query: 127 RVVTEKSRLAMPEVGIGYFPDVGGSYFLSRIPGE 160 + ++K+ +G G+ FL+R+ GE Sbjct: 121 TICSDKAVFGQVGPKMGSVDPGYGTAFLARVVGE 154 Lambda K H 0.322 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 260 Length adjustment: 27 Effective length of query: 329 Effective length of database: 233 Effective search space: 76657 Effective search space used: 76657 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory