Align methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.27) (characterized)
to candidate WP_108402347.1 B9Z44_RS09990 aldehyde dehydrogenase family protein
Query= BRENDA::Q6Z4E4 (534 letters) >NCBI__GCF_003063475.1:WP_108402347.1 Length = 485 Score = 191 bits (484), Expect = 7e-53 Identities = 134/442 (30%), Positives = 218/442 (49%), Gaps = 12/442 (2%) Query: 39 PRVRLLIGGEFVESRADEHVDVTNPATQEVVSRIPLTTADEFRAAVDAARTAF--PGWRN 96 P+ LI E+ +++ + D NPA V+ R + + AA+ AAR AF P W Sbjct: 3 PQALNLIDNEWQPAQSGQFEDSVNPADGRVIGRYAASDGADAEAAIAAARRAFERPDWAQ 62 Query: 97 TPVTTRQRIMLKYQELIRANMDKLAENITTEQGKTLKDAWGDVFRGLEVVEHACGMGTLQ 156 +P RQ +MLK+ + + A+ D+LA +T E GK L + G++ + + + G+ Sbjct: 63 SP-RLRQMVMLKWADRLEAHADELAHLLTLENGKVLAQSRGEMAGAISEIRYYAGLTRFI 121 Query: 157 MGEYVSNVSNGIDTFSIREPLGVCAGICPFNFPAMIPLWMFPIAVTCGNTFVLKPSEKDP 216 G +V V G + ++EP GV I P+N P ++ + A+ G T V+KP+ + Sbjct: 122 PG-HVFEVEPGAYSTLLKEPAGVAGIIVPWNAPVVLLIRSITPALAAGCTTVIKPAPQTA 180 Query: 217 G-AAMMLAELAMEAGLPKGVLNIVHGT-HDVVNNICDDEDIKAVSFVGSNIAGMHIYSRA 274 A +LA+L A LP+GVLN+V H V + D+ +SF GSN G I + A Sbjct: 181 LITAAVLADLQAVAELPRGVLNLVSECGHAVAQALTTSADVDVISFTGSNATGQRIMAAA 240 Query: 275 SAKGKRVQSNMGAKNHAIILPDADRDATLNALIAAGFGAAGQRCMALSTA-VFVGGSEPW 333 + K++ +G K+ ++ D D L AA +GQ+C A V + Sbjct: 241 APTMKKLSLELGGKSCCLVFDDVDVSRIAPQLAAAATIISGQQCTAARRVLVHASRYDEM 300 Query: 334 EDELVKRASSLVVNSGMASDADLGPVISKQAKERICKLIQSGADNGARVLLDGRDIVVPN 393 + L + +LVV G+A+ A LGP+I + +R+ + I D V+L G P+ Sbjct: 301 KVALSQALQALVVAPGLAAGAQLGPLIDAPSHQRVSQAIAQATDLADEVILRGGR---PD 357 Query: 394 --FENGNFVGPTLLADVKSEMECYKEEIFGPVLLLMKAESLDDAIQIVNRNKYGNGASIF 451 +G+F+ PTL+A + ++EIFGP ++L K E DA++ N + YG AS++ Sbjct: 358 GLSASGHFMTPTLVAHRDTSAFFVQDEIFGPFVVLEKFEDEQDAVKRANHSDYGLSASVW 417 Query: 452 TTSGVSARKFQTDIEAGQVGIN 473 T G + + G V +N Sbjct: 418 TQDGARQMRVARALRNGTVWLN 439 Lambda K H 0.318 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 470 Number of extensions: 30 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 534 Length of database: 485 Length adjustment: 34 Effective length of query: 500 Effective length of database: 451 Effective search space: 225500 Effective search space used: 225500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory