Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_109942363.1 DLD82_RS17185 ATP-binding cassette domain-containing protein
Query= uniprot:G8ALJ0 (294 letters) >NCBI__GCF_003173335.1:WP_109942363.1 Length = 329 Score = 85.1 bits (209), Expect = 2e-21 Identities = 79/279 (28%), Positives = 124/279 (44%), Gaps = 29/279 (10%) Query: 16 HLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGFYTPTVGRLTLRHADG 75 +LT +FG L AVN ++ + + G I ++GPNGAGK+TL + + PT G T+ +G Sbjct: 8 NLTKQFGTLTAVNSLNLAIHKGTIFGLLGPNGAGKSTLLSMLCTILNPTSGTATV---NG 64 Query: 76 KEFLLERMPGYRISQKASVARTFQNIRLFGGMSVLENLIVAQHNKLIRASGFSIAGLLGL 135 + L E + S+ FQ+I + ++ ENL H L IAG + Sbjct: 65 YDILTESE-----KVRQSIGIVFQSISIDDRLTGRENL--KFHAMLYNVPEDKIAGRID- 116 Query: 136 PSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIARAMCTEPVMLCLDEP 195 E + L + L + AD G RRLE+AR + P +L LDEP Sbjct: 117 --------EVLAL-------LELSDRADDLVRTYSGGMIRRLEMARGLLHHPHILFLDEP 161 Query: 196 AAGLNPRESGELADLLTYIRDEHK--IGVLLIEHDMSVVMTISDHVVVLDYGRKISDGDP 253 GL+P+ + + + + K + VLL H M + D V ++D G+ I P Sbjct: 162 TIGLDPQTREHIWSYIQELTRKKKGDLTVLLTTHYMDEADLLCDEVAIIDKGQIIVRDTP 221 Query: 254 AFVKNDPAVIRAYLGEEEDEELPPEIKADLPEVAKRAEE 292 +K D + + E L + +D P + K + E Sbjct: 222 GNLKQDLQGEKISFNMKSPEIL-ASLLSDNPRICKVSTE 259 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 329 Length adjustment: 27 Effective length of query: 267 Effective length of database: 302 Effective search space: 80634 Effective search space used: 80634 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory