Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate WP_109942102.1 DLD82_RS15815 amino acid ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc02869 (352 letters) >NCBI__GCF_003173335.1:WP_109942102.1 Length = 250 Score = 161 bits (407), Expect = 2e-44 Identities = 96/237 (40%), Positives = 138/237 (58%), Gaps = 6/237 (2%) Query: 20 LQLKTIRKAFGSHEVLKGIDLDVKDGEFVIFVGPSGCGKSTLLRTIAGLEDATSGSVQID 79 L+++ I+KAFG+++VL+G+ ++V+ GE V F+GPSG GKSTLLR I L SG + ++ Sbjct: 8 LRVENIKKAFGTNQVLQGVSVNVRKGETVCFIGPSGTGKSTLLRCINQLTIPDSGKIFLN 67 Query: 80 GVEVGHVAPA----KRGIAMVFQSYALYPHLTVKDNMGLG-LKQAGVPKAEIEEKVAKAA 134 EV H P ++ I MVFQ++ L+ HLT N+ + LK +P E EK Sbjct: 68 DEEVTHAGPRINYFRQKIGMVFQNFFLFDHLTAVRNVEIALLKVKKLPPKEAREKALYEL 127 Query: 135 GMLSLEPYLARRPAELSGGQRQRVAIGRAIVREPKLFLFDEPLSNLDAALRVNTRLEIAR 194 + + + PAELSGGQ QRV+I RA+ +P++ LFDEP S LD L LE+ + Sbjct: 128 RQVGMADWADHYPAELSGGQAQRVSIARALAMDPEIMLFDEPTSALDPEL-TREVLEVMK 186 Query: 195 LHRSLKATMIYVTHDQVEAMTLADKIVVLNAGRIEQVGSPMELYNRPANLFVAGFIG 251 TM+ VTH+ A ++A+KI + G I++ GSP EL N P FIG Sbjct: 187 KLALQGMTMLVVTHEMGFACSVANKICFMEHGHIKEEGSPAELLNNPEFERCKAFIG 243 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 250 Length adjustment: 26 Effective length of query: 326 Effective length of database: 224 Effective search space: 73024 Effective search space used: 73024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory