Align NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_109940251.1 DLD82_RS06220 ABC transporter ATP-binding protein
Query= TCDB::Q7A2H0 (260 letters) >NCBI__GCF_003173335.1:WP_109940251.1 Length = 303 Score = 96.3 bits (238), Expect = 7e-25 Identities = 73/238 (30%), Positives = 117/238 (49%), Gaps = 22/238 (9%) Query: 9 LPLLAASGLCKSFGGIKAVQEARIEVAQGSITGLIGPNGAGKTTLFNLLSNFI-RPDKGR 67 LP++ ASGL K + + AV V +G + G +GPNGAGKTT ++ R D Sbjct: 3 LPVIEASGLIKRYRDLTAVNSIHFSVPKGELFGFLGPNGAGKTTTMKMVQCVSPRTDGTL 62 Query: 68 VIFDGEPIQQLQPHQIAQQ-GMVRTFQVARTLSRLSVLENMLLAAQKQTGENFWQVQLQP 126 +F +P +I ++ G+V Q LSV +N+ + A+ F+ + Q Sbjct: 63 RVFGMDP--DTSGREIRKRIGVVP--QETNLDPDLSVFDNLSMYAR------FFDISSQ- 111 Query: 127 QVVVKEEKQLQEQAMFLLESVGLAKKAYEYAGGLSGGQRKLLEMGRALMTNPKLILLDEP 186 +A LLE L K LSGG ++ L + RAL+ P+L++LDEP Sbjct: 112 --------DADFRAQELLEFFELETKRDTIIEKLSGGMKRRLLLARALINRPELLILDEP 163 Query: 187 AAGVNPRLIDDICDRILTWNRQDGMTFLIIEHNMDVIMSLCDRVWVLAEGQNLADGTP 244 G++P+ I ++++ R DG T ++ H +D LCDR+ ++ G L +G+P Sbjct: 164 TIGLDPQARHHIWEKLIKL-RADGHTIVLTTHYLDEAARLCDRLVIMDVGSILVEGSP 220 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 303 Length adjustment: 26 Effective length of query: 234 Effective length of database: 277 Effective search space: 64818 Effective search space used: 64818 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory