Align Ornithine cyclodeaminase; OCD; EC 4.3.1.12 (uncharacterized)
to candidate WP_109941397.1 DLD82_RS12180 ornithine cyclodeaminase family protein
Query= curated2:Q59175 (359 letters) >NCBI__GCF_003173335.1:WP_109941397.1 Length = 318 Score = 117 bits (294), Expect = 3e-31 Identities = 83/242 (34%), Positives = 120/242 (49%), Gaps = 15/242 (6%) Query: 75 GFKYVNGHPKNTRDGLQTVTAFGVLADVGSGYPMLLTEMTILTALRTAATSAVAAKHLAP 134 G K VN HP N GL TV + +L D +G P+ + + LTALRT A++AVA LAP Sbjct: 61 GVKVVNVHPDNPTIGLPTVMSMTILLDPPTGKPIAVLNTSNLTALRTGASAAVATSVLAP 120 Query: 135 KNARTMAIIGNGAQSEFQALAFKAILGVDKLRLYDLDPQATAKCIRNLQGAGFNIVACKS 194 K + IIG+G Q+ +A + ++R++ + + +V K Sbjct: 121 KKKGIVGIIGSGRQAMAGLMALNHVFEPMEVRVWSRSMKHAERFASQFPNLPVQVVELKK 180 Query: 195 VEEAVEGADIITTVTADKANATILTDNMVGAGVHINAVGGDCSGKTELHGDILRRSDIFV 254 + AD++ TVT + A +++D + G HINA+G D GK EL IL R+++FV Sbjct: 181 AAD----ADVLLTVT--PSEAPLISDEWIAQGTHINAMGADARGKQELDPAILSRAEVFV 234 Query: 255 EYPPQTRIEGEIQ-------QLPEDYPVNELWEVITGRIAGRKDARQITLFDSVGFATED 307 + Q GEI PE L EVITG+I+ R IT+FDS G A D Sbjct: 235 DDLMQAVHSGEINVPISTGIYHPEQV-AGTLGEVITGKIS-RSSPDAITVFDSTGIAITD 292 Query: 308 FS 309 + Sbjct: 293 LA 294 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 318 Length adjustment: 28 Effective length of query: 331 Effective length of database: 290 Effective search space: 95990 Effective search space used: 95990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory