Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_109939172.1 DLD82_RS00420 glycine betaine/L-proline ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_003173335.1:WP_109939172.1 Length = 376 Score = 135 bits (340), Expect = 1e-36 Identities = 81/234 (34%), Positives = 130/234 (55%), Gaps = 10/234 (4%) Query: 33 GQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIVDGIELTSDLKN 92 G L++I+ +V +GE V+ G SG GKST++RC+NRL +G I++DG ++ S Sbjct: 19 GHVVALKNISFSVKKGEIFVLMGLSGCGKSTLLRCLNRLISPTAGSILLDGEDIASVSTE 78 Query: 93 IDKV--RSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEETAMYYLEKVKIPEQ 150 + RS +GMVFQ F L PH I +N+ + ++ + E A L+ V + Sbjct: 79 RMRTIRRSRMGMVFQSFALLPHKNIQDNVAFG-LEIQGISAEERAGIAKETLDLVGLSGY 137 Query: 151 AQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDP----EMIKEVLDTMIQLAEE 206 YP QLSGG +QRV +AR++ P I+L DE SALDP +M E+LD +L + Sbjct: 138 ENSYPDQLSGGMKQRVGLARAIASSPDILLMDEAFSALDPMIRRDMQNELLDIQDRLEK- 196 Query: 207 GMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTKQFLSQI 260 T++ V+H++ A + R+ M G+IV+ P + P++E ++F+ + Sbjct: 197 --TIIFVSHDLDEALKLGTRIGLMKAGEIVQIGTPEEILTQPKNEFVERFVEDV 248 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 376 Length adjustment: 27 Effective length of query: 236 Effective length of database: 349 Effective search space: 82364 Effective search space used: 82364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory