Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate WP_109939548.1 DLD82_RS02635 iron ABC transporter permease
Query= CharProtDB::CH_004160 (318 letters) >NCBI__GCF_003173335.1:WP_109939548.1 Length = 360 Score = 166 bits (421), Expect = 6e-46 Identities = 95/275 (34%), Positives = 155/275 (56%), Gaps = 5/275 (1%) Query: 46 VLMEYRLPRLLLALFVGAALAVAGVLIQGIVRNPLASPDILGVNHAA----SLASVGALL 101 VL + R PR+ +A+F G AL + GV++Q +++NPLA P ++G+ AA SLA + Sbjct: 79 VLWKLRFPRIFMAIFAGMALGITGVVMQSVLKNPLADPYMMGIQSAAGFGASLAIIFGTG 138 Query: 102 LMPSLPVMVLPLLAFAGGMAGLILLKMLAKTHQPMKLALTGVALSACWASLTDYLM-LSR 160 + ++ F+ G+I+L K + LTG+A+ ++++T ++ + Sbjct: 139 FLSGGYLIAGNAFLFSLIAVGIIILLSDMKDASAETMILTGIAVMFFFSAMTTFIQYFAE 198 Query: 161 PQDVNNALLWLTGSLWGRDWSFVKIAIPLMILFLPLSLSFCRDLDLLALGDARATTLGVS 220 + V +A+ W G L W I IPL++ L D+++LA GD A +LG+ Sbjct: 199 AEAVKSAMFWAVGDLGKTSWDDFYIVIPLLVCCFLFLLWKTWDMNILAAGDETAKSLGIP 258 Query: 221 VPHTRFWALLLAVAMTSTGVAACGPISFIGLVVPHMMRSITGGRHRRLLPVSALTGALLL 280 V R ++++ + S V G I F+GLV PH+ R I GG ++ LLP S L GA+LL Sbjct: 259 VRRVRITIMIVSSLLVSGVVCFIGAIGFVGLVSPHICRLIIGGDNQYLLPASGLVGAVLL 318 Query: 281 VVADLLARIIHPPLELPVGVLTAIIGAPWFVWLLV 315 +V+D +AR I P +PVGV+TA IG P+F++L++ Sbjct: 319 IVSDTVARTIMSPAIIPVGVITAFIGVPFFIYLIM 353 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 360 Length adjustment: 28 Effective length of query: 290 Effective length of database: 332 Effective search space: 96280 Effective search space used: 96280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory