Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate WP_109941010.1 DLD82_RS10240 ATP-binding cassette domain-containing protein
Query= reanno::Smeli:SM_b21106 (365 letters) >NCBI__GCF_003173335.1:WP_109941010.1 Length = 209 Score = 159 bits (402), Expect = 6e-44 Identities = 85/207 (41%), Positives = 130/207 (62%), Gaps = 3/207 (1%) Query: 4 VTLKKLVKRYGALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAIEIG 63 + ++ L+ R G+ E+ +L+V D +++ + G SG GK+ L IAG + G+I + Sbjct: 2 IRIRDLLVRVGSFELPVK-NLDVSDNDWVVITGRSGSGKTVFLETIAGFFKPESGSIILD 60 Query: 64 GRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAILDL 123 G + LPP R IS+VFQ Y+L+PHMT EN+G+ LK+ P EI + V++ A +L + Sbjct: 61 GADITSLPPEKRGISIVFQDYSLFPHMTARENIGYGLKLRNNP--EIHSIVSDYARMLGI 118 Query: 124 AHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLHARM 183 LL+R P+QLSGG++QRVA+ RA+V P + L DEP S LD + R + ++ LH R Sbjct: 119 DSLLDRSPAQLSGGEKQRVAIARALVVNPKLLLLDEPASALDHETRRSLWNDLCSLHDRG 178 Query: 184 QATMIYVTHDQVEAMTLSDRIVIMRDG 210 T+I+VTHD+ EA L +R +I+ G Sbjct: 179 DLTIIHVTHDRNEAEVLGNRRIIIDGG 205 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 209 Length adjustment: 25 Effective length of query: 340 Effective length of database: 184 Effective search space: 62560 Effective search space used: 62560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory