Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_109941010.1 DLD82_RS10240 ATP-binding cassette domain-containing protein
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_003173335.1:WP_109941010.1 Length = 209 Score = 148 bits (374), Expect = 1e-40 Identities = 78/189 (41%), Positives = 117/189 (61%), Gaps = 3/189 (1%) Query: 23 NLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTLEIDGTVVNDVPPAQRGIAMVFQ 82 NLD+ + +V G SG GK+ L IAG K G++ +DG + +PP +RGI++VFQ Sbjct: 20 NLDVSDNDWVVITGRSGSGKTVFLETIAGFFKPESGSIILDGADITSLPPEKRGISIVFQ 79 Query: 83 SYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEKLQLGQYLDRLPKALSGGQRQRV 142 Y+L+PHMT REN+ + LK+ ++ EI + V A L + LDR P LSGG++QRV Sbjct: 80 DYSLFPHMTARENIGYGLKL--RNNPEIHSIVSDYARMLGIDSLLDRSPAQLSGGEKQRV 137 Query: 143 AIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQLKEAMPESTMVYVTHDQVEAMTLA 202 AI R++V +PK+ L DEP S LD R + ++ L + + T+++VTHD+ EA L Sbjct: 138 AIARALVVNPKLLLLDEPASALDHETRRSLWNDLCSLHD-RGDLTIIHVTHDRNEAEVLG 196 Query: 203 TRIVVLAGG 211 R +++ GG Sbjct: 197 NRRIIIDGG 205 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 209 Length adjustment: 25 Effective length of query: 348 Effective length of database: 184 Effective search space: 64032 Effective search space used: 64032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory