Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_109942090.1 DLD82_RS15755 ATP-binding cassette domain-containing protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_003173335.1:WP_109942090.1 Length = 328 Score = 103 bits (258), Expect = 4e-27 Identities = 75/247 (30%), Positives = 120/247 (48%), Gaps = 26/247 (10%) Query: 15 LKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMITFN 74 ++V L+ K+G L+A+N+ SF +G+I L+GPNGAGKTT + ++ KP+ G T Sbjct: 5 IQVHDLTKKYGNLVAVNNISFGIMQGEIFGLLGPNGAGKTTTLSMLSTMQKPSSGTATVQ 64 Query: 75 QKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYTILG 134 K +E+ D + FQ+ L LT EN+ H +L + Sbjct: 65 GKD-----VEKNED---DVRKAIGIVFQDQSLDEELTAGENMNF--HGRLYR-------- 106 Query: 135 LIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGPELLC 194 + P +R+ +L R +L DR +D G +RRLEIAR + P +L Sbjct: 107 ---IPPDERDK-RIDDLLRL----VELYDRKNDIVKTFSGGMRRRLEIARGLLHHPSVLF 158 Query: 195 LDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQKISDG 254 LDEP GL+P+ L + + E +I+L H M + D + ++++G I+ Sbjct: 159 LDEPTLGLDPQTRNHLWQYIADLSKEKHITIILTTHYMEEADRLCDRIAIIDHGSIIALD 218 Query: 255 TPDHVKN 261 TP ++KN Sbjct: 219 TPQNLKN 225 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 328 Length adjustment: 27 Effective length of query: 265 Effective length of database: 301 Effective search space: 79765 Effective search space used: 79765 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory