Align 5-aminopentanamidase (EC 3.5.1.30) (characterized)
to candidate WP_109941570.1 DLD82_RS13045 carbon-nitrogen hydrolase family protein
Query= reanno::pseudo5_N2C3_1:AO356_14225 (264 letters) >NCBI__GCF_003173335.1:WP_109941570.1 Length = 256 Score = 87.4 bits (215), Expect = 3e-22 Identities = 76/256 (29%), Positives = 114/256 (44%), Gaps = 6/256 (2%) Query: 1 MRVALYQCPPLPLDPAGNLHRLHQVALEARGADV--LVLPEMFMTGYNIGVDAVNVLAEV 58 M ++L Q P DP L ++ + A EA D LV PE +TG++ N Sbjct: 1 MILSLAQITPCWNDPTKTLKKMEKYAAEAVEGDATFLVFPEQILTGWD---PKNNSEVTT 57 Query: 59 YNGEWAQQIGRIAKAANLAIVYGYPERGEDGQIYNAVQLIDAQGERLANYRKSHLFGDLD 118 +GE + IA+ ++ I+ + E+ D +N I G+ LA+Y+K HLF Sbjct: 58 EDGEEISALKDIAQDYSIGILGSFREKNTDHP-FNTSIAIGPDGKTLASYQKIHLFSPAG 116 Query: 119 HAMFSAGDSALPIVELNGWKLGLLICYDLEFPENARRLALAGAELILVPTANMQPYEFIA 178 + + ++L I N +G+ ICYDL F AG L+LVP+A Sbjct: 117 EDRYFSPGNSLGIFSFNSCTIGIAICYDLRFAPLFHAYRDAGVNLMLVPSAWPASRLKHF 176 Query: 179 DVTVRARAIENQCFVAYANYCGHEAELQYCGQSSIAAPNGSRPALAGLDEALIVGELDRQ 238 + +RA E Q FVA N G Y G S IA P+GS A E LI ++ + Sbjct: 177 HLFTTSRAAEFQMFVASVNTVGQTPVDFYNGGSCIAGPDGSIRAQGTDLEELIFYDMPIE 236 Query: 239 LLDDSRAAYNYLHDRR 254 + R ++ + D R Sbjct: 237 EAETLRISFPFHKDVR 252 Lambda K H 0.321 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 256 Length adjustment: 24 Effective length of query: 240 Effective length of database: 232 Effective search space: 55680 Effective search space used: 55680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory