Align 1-piperideine-2-carboxylate/1-pyrroline-2-carboxylate reductase (NADPH) (EC 1.5.1.21) (characterized)
to candidate WP_109941397.1 DLD82_RS12180 ornithine cyclodeaminase family protein
Query= BRENDA::O54983 (313 letters) >NCBI__GCF_003173335.1:WP_109941397.1 Length = 318 Score = 127 bits (320), Expect = 3e-34 Identities = 83/257 (32%), Positives = 137/257 (53%), Gaps = 12/257 (4%) Query: 57 GFLGVMPAYSAAEDALTTKLVTFYEGHSNTAVPSHQASVLLFDPSNGSLLAVMDGNVITA 116 G MP+Y + + K+V + + +P+ + +L DP G +AV++ + +TA Sbjct: 45 GDFRTMPSYLPSLNVAGVKVVNVHPDNPTIGLPTVMSMTILLDPPTGKPIAVLNTSNLTA 104 Query: 117 KRTAAVSAIATKLLKPPGSDVLCILGAGVQAYSHYEIFTEQFSFKEVRMWNRTRENAEKF 176 RT A +A+AT +L P ++ I+G+G QA + F EVR+W+R+ ++AE+F Sbjct: 105 LRTGASAAVATSVLAPKKKGIVGIIGSGRQAMAGLMALNHVFEPMEVRVWSRSMKHAERF 164 Query: 177 ASTVQG-DVRVCSSVQEAVTGADVIITVTMATEPILFGEWVKPGAHINAVGASRPDWREL 235 AS V+V + A ADV++TVT + P++ EW+ G HINA+GA +EL Sbjct: 165 ASQFPNLPVQVVELKKAA--DADVLLTVTPSEAPLISDEWIAQGTHINAMGADARGKQEL 222 Query: 236 DDELMRQAVLYVDSREAALKESGDV-------LLSGADIFAELGEVISG-AKPAHCEKTT 287 D ++ +A ++VD A+ SG++ + + LGEVI+G + + T Sbjct: 223 DPAILSRAEVFVDDLMQAV-HSGEINVPISTGIYHPEQVAGTLGEVITGKISRSSPDAIT 281 Query: 288 VFKSLGMAVEDLVAAKL 304 VF S G+A+ DL A L Sbjct: 282 VFDSTGIAITDLAVAHL 298 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 318 Length adjustment: 27 Effective length of query: 286 Effective length of database: 291 Effective search space: 83226 Effective search space used: 83226 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory