Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate WP_109941010.1 DLD82_RS10240 ATP-binding cassette domain-containing protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >NCBI__GCF_003173335.1:WP_109941010.1 Length = 209 Score = 152 bits (384), Expect = 8e-42 Identities = 77/187 (41%), Positives = 120/187 (64%), Gaps = 2/187 (1%) Query: 26 LKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGGAILVDDADISGMSPKDRDIAMVFQS 85 L + D +++++ G SG GK+ + IAG G+I++D ADI+ + P+ R I++VFQ Sbjct: 21 LDVSDNDWVVITGRSGSGKTVFLETIAGFFKPESGSIILDGADITSLPPEKRGISIVFQD 80 Query: 86 YALYPTMSVRDNIAFGLKIRKMPTAEIDEEVARVSKLLQIEHLLSRKPGQLSGGQQQRVA 145 Y+L+P M+ R+NI +GLK+R P EI V+ +++L I+ LL R P QLSGG++QRVA Sbjct: 81 YSLFPHMTARENIGYGLKLRNNP--EIHSIVSDYARMLGIDSLLDRSPAQLSGGEKQRVA 138 Query: 146 MGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKLMHQRLKTTTVYVTHDQIEAMTLGDK 205 + RAL PK+ L DEP S LD + R + ++ +H R T ++VTHD+ EA LG++ Sbjct: 139 IARALVVNPKLLLLDEPASALDHETRRSLWNDLCSLHDRGDLTIIHVTHDRNEAEVLGNR 198 Query: 206 VAVMKDG 212 ++ G Sbjct: 199 RIIIDGG 205 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 209 Length adjustment: 26 Effective length of query: 360 Effective length of database: 183 Effective search space: 65880 Effective search space used: 65880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory