Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_109941010.1 DLD82_RS10240 ATP-binding cassette domain-containing protein
Query= BRENDA::Q70HW1 (384 letters) >NCBI__GCF_003173335.1:WP_109941010.1 Length = 209 Score = 159 bits (402), Expect = 7e-44 Identities = 85/198 (42%), Positives = 124/198 (62%), Gaps = 4/198 (2%) Query: 15 GQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEGNLYIGDRRVNDVPP 74 G E VK NLD+ D ++ V G SG GKT L IAG G++ + + +PP Sbjct: 12 GSFELPVK--NLDVSDNDWVVITGRSGSGKTVFLETIAGFFKPESGSIILDGADITSLPP 69 Query: 75 KDRDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAAKILDIAHLLDRKPK 134 + R I++VFQ+Y+L+PHMT +N+ +GLKLR P EI V + A++L I LLDR P Sbjct: 70 EKRGISIVFQDYSLFPHMTARENIGYGLKLRNNP--EIHSIVSDYARMLGIDSLLDRSPA 127 Query: 135 ALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRKLHQRLQTTVIYVTH 194 LSGG++QRVA+ RA+V P++ L+DEP S LD + R + ++ LH R T+I+VTH Sbjct: 128 QLSGGEKQRVAIARALVVNPKLLLLDEPASALDHETRRSLWNDLCSLHDRGDLTIIHVTH 187 Query: 195 DQTEAMTMGDRIVVMRDG 212 D+ EA +G+R +++ G Sbjct: 188 DRNEAEVLGNRRIIIDGG 205 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 209 Length adjustment: 26 Effective length of query: 358 Effective length of database: 183 Effective search space: 65514 Effective search space used: 65514 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory