Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_109942363.1 DLD82_RS17185 ATP-binding cassette domain-containing protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_003173335.1:WP_109942363.1 Length = 329 Score = 111 bits (277), Expect = 2e-29 Identities = 82/260 (31%), Positives = 127/260 (48%), Gaps = 34/260 (13%) Query: 24 LSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLFNGDSIG 83 L+K FG L AV+ ++ + +G+I GL+GPNGAGK+TL ++L + P G NG I Sbjct: 9 LTKQFGTLTAVNSLNLAIHKGTIFGLLGPNGAGKSTLLSMLCTILNPTSGTATVNGYDI- 67 Query: 84 QLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFRRVQKEERAN 143 L + + FQ + RLT EN+ KF L N V +++ A Sbjct: 68 -LTESEKVRQSIGIVFQSISIDDRLTGRENL----------KFHAMLYN---VPEDKIAG 113 Query: 144 R-EKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAAGVNPTLI 202 R ++ +A+LE L +A D SGG + LEMAR L+ +P ++ LDEP G++P Sbjct: 114 RIDEVLALLE---LSDRADDLVRTYSGGMIRRLEMARGLLHHPHILFLDEPTIGLDPQTR 170 Query: 203 GQICEHIVNWNRQ---GITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQIQSD--- 256 I +I R+ +T L+ H MD LC V ++ +G+ + TP ++ D Sbjct: 171 EHIWSYIQELTRKKKGDLTVLLTTHYMDEADLLCDEVAIIDKGQIIVRDTPGNLKQDLQG 230 Query: 257 ---------PRVLEAYLGDS 267 P +L + L D+ Sbjct: 231 EKISFNMKSPEILASLLSDN 250 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 329 Length adjustment: 26 Effective length of query: 241 Effective length of database: 303 Effective search space: 73023 Effective search space used: 73023 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory