Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_109939172.1 DLD82_RS00420 glycine betaine/L-proline ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1302 (334 letters) >NCBI__GCF_003173335.1:WP_109939172.1 Length = 376 Score = 161 bits (407), Expect = 3e-44 Identities = 86/234 (36%), Positives = 137/234 (58%), Gaps = 6/234 (2%) Query: 7 ESVTKNFGPVEVIPPLDLTIEDGEFTVFVGPSGCGKSTLLRLIAGLEDITSGTIRIDGED 66 + + + G V + + +++ GE V +G SGCGKSTLLR + L T+G+I +DGED Sbjct: 12 KEIRERTGHVVALKNISFSVKKGEIFVLMGLSGCGKSTLLRCLNRLISPTAGSILLDGED 71 Query: 67 ATNIPPAKRG------LAMVFQSYALYPHMSVRKNIAFPMKMAGIPADEQKRRIDNAAAA 120 ++ + + MVFQS+AL PH +++ N+AF +++ GI A+E+ Sbjct: 72 IASVSTERMRTIRRSRMGMVFQSFALLPHKNIQDNVAFGLEIQGISAEERAGIAKETLDL 131 Query: 121 LNLTDYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVGMRLEISELH 180 + L+ Y + P QLSGG +QRV + RAI P L DE S LD +R M+ E+ ++ Sbjct: 132 VGLSGYENSYPDQLSGGMKQRVGLARAIASSPDILLMDEAFSALDPMIRRDMQNELLDIQ 191 Query: 181 KRLATTMIYVTHDQVEAMTMADKIVVLQAGVIEQVGSPMELYRAPRNVFVAGFI 234 RL T+I+V+HD EA+ + +I +++AG I Q+G+P E+ P+N FV F+ Sbjct: 192 DRLEKTIIFVSHDLDEALKLGTRIGLMKAGEIVQIGTPEEILTQPKNEFVERFV 245 Lambda K H 0.320 0.138 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 376 Length adjustment: 29 Effective length of query: 305 Effective length of database: 347 Effective search space: 105835 Effective search space used: 105835 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory