Align Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter periplasmic binding protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate WP_109969946.1 DK846_RS15725 basic amino acid ABC transporter substrate-binding protein
Query= TCDB::Q9HU31 (250 letters) >NCBI__GCF_003173355.1:WP_109969946.1 Length = 270 Score = 133 bits (335), Expect = 3e-36 Identities = 83/223 (37%), Positives = 114/223 (51%), Gaps = 10/223 (4%) Query: 28 RIGTEGAYPPFNGIDASGQAVGFDLDIGKALCAKMKTECEVVTSDWDGIIPALNAKKFDF 87 R+G + YPPF + G+ GFD++ K + E E WDGIIPALNA K D Sbjct: 49 RVGIDPVYPPFTMMSEKGEPTGFDVESLKWIAKDQGFEAEFQGIAWDGIIPALNANKIDM 108 Query: 88 IVASMSITDERKQAVDFTDPYYTNKLQFVAPKSVDFKTDKDSLKGKVIGAQRATIAGTWL 147 + A M+ITDERK+ VDF+ PY+T V + D+ IG QR A W+ Sbjct: 109 VYAGMTITDERKEKVDFSKPYWTVNQTVVTKQGSPITMDQVKSGKATIGTQRGCTAAIWV 168 Query: 148 EDNMAD-----VVTIKLYDTQENAYLDLSSGRLDGVLADKFVQYDWLKSDAGKEFEFKGE 202 EDN+ + +K YD A DL +GR D V+ D V D ++ GK + G Sbjct: 169 EDNLVNKSLMSADNLKQYDNTPLAVEDLVAGRTDAVIYDSTVINDIIE---GKPVQKIGS 225 Query: 203 PVFDNDKIGIAVRKGD-PLREKLNAALKEIVADGTYKKINDKY 244 + N++ GIAVRK D L +KLN L ++A +K + KY Sbjct: 226 -IETNEQFGIAVRKSDAELLKKLNTGLDHLMASPDWKALVQKY 267 Lambda K H 0.317 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 270 Length adjustment: 24 Effective length of query: 226 Effective length of database: 246 Effective search space: 55596 Effective search space used: 55596 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory