Align arginine-pyruvate transaminase (EC 2.6.1.84) (characterized)
to candidate WP_109968747.1 DK846_RS09780 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= BRENDA::Q9HUI9 (393 letters) >NCBI__GCF_003173355.1:WP_109968747.1 Length = 385 Score = 219 bits (557), Expect = 1e-61 Identities = 119/352 (33%), Positives = 198/352 (56%), Gaps = 2/352 (0%) Query: 32 EEILLLSVGDPDFDTPAPIVQAAIDSLLAGNTHYADVRGKRALRQRIAERHRRRSGQAVD 91 E+++ L VG+PD+ TP I +AAI S+ G+T Y G LR+ ++ R + D Sbjct: 28 EDVISLGVGEPDYTTPWHICEAAITSIEQGHTSYTSNTGLETLRRDLSSFLNNRYQISYD 87 Query: 92 A-EQVVVLAGAQCALYAVVQCLLNPGDEVIVAEPMYVTYEAVFGACGARVVPVPVRSENG 150 +++V G AL ++ +++PGDE +V +P+YV+Y G + V +P ++ Sbjct: 88 PLSEMIVTTGVSEALDIAIRAVIDPGDEALVVDPIYVSYGPCVTLAGGKPVLMPCLEKDH 147 Query: 151 FRVQAEEVAALITPRTRAMALNSPHNPSGASLPRATWEALAELCMAHDLWMISDEVYSEL 210 FR+ + + ITP+++ + LN P+NPSGA + + + +A++ + HDL ++SDEVY+EL Sbjct: 148 FRLTPDLLMEHITPKSKVLILNFPNNPSGAVMRKEDIKGIADVAIDHDLLILSDEVYAEL 207 Query: 211 LFDGEHVSPASLPGMADRTATLNSLSKSHAMTGWRVGWVVGPAALCAHLENLALCMLYGS 270 ++G+H + AS+ G+ +RT TL+ SK+ AMTGWR+G+ P + A + ++ + Sbjct: 208 TYEGKHCAVASVDGLWERTVTLSGFSKAFAMTGWRLGYFCAPKEITAAALKIHQYIMLSA 267 Query: 271 PEFIQDAACTALEAPLPELEAMREAYRRRRDLVIECLADSPGLRPLRPDGGMFVMVDIRP 330 P Q A AL +E M Y RR+L ++ L + GL P+G + ++ Sbjct: 268 PTMAQYGAIEALRHGQDPMEQMVREYHMRRNLFVDGL-NRIGLPCHLPEGAFYAFPSVKQ 326 Query: 331 TGLSAQAFADRLLDRHGVSVLAGEAFGPSAAGHIRLGLVLGAEPLREACRRI 382 TGLS Q FA+RL+ GV+V+ G FG + GH+R + L EA R+ Sbjct: 327 TGLSDQEFAERLITEAGVAVVPGSVFGTAGEGHVRCAYAVSRNDLSEAIARM 378 Lambda K H 0.322 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 385 Length adjustment: 30 Effective length of query: 363 Effective length of database: 355 Effective search space: 128865 Effective search space used: 128865 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory