Align Ornithine cyclodeaminase; OCD; EC 4.3.1.12 (uncharacterized)
to candidate WP_109969086.1 DK846_RS11430 ornithine cyclodeaminase family protein
Query= curated2:Q59175 (359 letters) >NCBI__GCF_003173355.1:WP_109969086.1 Length = 313 Score = 116 bits (291), Expect = 7e-31 Identities = 77/241 (31%), Positives = 116/241 (48%), Gaps = 13/241 (5%) Query: 75 GFKYVNGHPKNTRDGLQTVTAFGVLADVGSGYPMLLTEMTILTALRTAATSAVAAKHLAP 134 G K VN HP N GL TV +L D +G P+ + T LT LRT A +AVA LAP Sbjct: 61 GVKVVNVHPNNRAQGLPTVMGTIILLDPPTGRPVAIFNATGLTNLRTGAAAAVATSTLAP 120 Query: 135 KNARTMAIIGNGAQSEFQALAFKAILGVDKLRLYDLDPQATAKCIRNLQGAGFNIVACKS 194 T+ +IG G Q+ LA K +L ++ +R++ + + I + K Sbjct: 121 MKQGTLGMIGAGQQARSGLLAIKEVLEIESVRVWSRSLKTAEHLVAEFPTLDITITSPKH 180 Query: 195 VEEAVEGADIITTVTADKANATILTDNMVGAGVHINAVGGDCSGKTELHGDILRRSDIFV 254 + +D++ T T + ++ ++ + G HINA+G D GK EL +LRR++IFV Sbjct: 181 TAD----SDVLLTTT--PSVKPVVMNDWISDGTHINAIGADAPGKQELESTLLRRAEIFV 234 Query: 255 EYPPQTRIEGEIQQ------LPEDYPVNELWEVITGRIAGRKDARQITLFDSVGFATEDF 308 + Q GE+ + D L EV+ G+I R +T+FDS G A D Sbjct: 235 DDIEQAIHSGEVNVPISSGFISPDSIRGTLGEVLVGKIQ-RSSRETVTIFDSTGIAITDL 293 Query: 309 S 309 + Sbjct: 294 A 294 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 313 Length adjustment: 28 Effective length of query: 331 Effective length of database: 285 Effective search space: 94335 Effective search space used: 94335 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory