Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_109968633.1 DK846_RS09135 phosphate ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_003173355.1:WP_109968633.1 Length = 253 Score = 136 bits (342), Expect = 5e-37 Identities = 83/259 (32%), Positives = 139/259 (53%), Gaps = 19/259 (7%) Query: 17 VSDEIAIQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQS 76 ++D+ I + +N WYG+ LR+I++ + + + GPSG GKST+IRC NR+ + S Sbjct: 1 MNDDTIINVRNLNLWYGETQALRNISMPIAHQKVTSLIGPSGCGKSTLIRCFNRMNDLVS 60 Query: 77 -----GKIIVDGIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAP-------- 123 G + G ++ + +R ++GMVFQ N FP TI EN+ P Sbjct: 61 GCRIEGSLTFHGRDIYGSGADAVDIRMQIGMVFQKPNPFPK-TIYENIAYGPRIHGIRDR 119 Query: 124 IWVRKVPKREAEETAMYYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDE 183 + ++ + ++ A++ K ++ + A LSGGQQQR+ IAR+L + P+I+L DE Sbjct: 120 AELDRIVESSLKKAALWEEVKTRLHDSAL----GLSGGQQQRLCIARTLAVNPEIILMDE 175 Query: 184 PTSALDPEMIKEVLDTMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHD 243 P SALDP ++ D + +L ++ ++ VTH M A V++ FM G ++E Sbjct: 176 PCSALDPIATAKIEDLIDELKKD-YCVVIVTHSMSQAARVSDFTAFMYLGDLIEFGETRQ 234 Query: 244 FFHNPQSERTKQFLSQILG 262 F NP+ E T+ +++ G Sbjct: 235 IFENPKKELTENYITGRFG 253 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 253 Length adjustment: 24 Effective length of query: 239 Effective length of database: 229 Effective search space: 54731 Effective search space used: 54731 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory