Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_109969613.1 DK846_RS14130 acetylornithine transaminase
Query= BRENDA::O30508 (406 letters) >NCBI__GCF_003173355.1:WP_109969613.1 Length = 384 Score = 243 bits (621), Expect = 5e-69 Identities = 151/391 (38%), Positives = 215/391 (54%), Gaps = 26/391 (6%) Query: 15 RYMVPNYAPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQRI 74 +Y++P ++ I +G G V D G++ +D GIAV S GH HP +VKA+ EQA + Sbjct: 13 QYIMPAFSREIMI-TKGSGCTVTDADGKQYLDLVAGIAVCSTGHCHPKVVKAIAEQAAEL 71 Query: 75 WHVSNVFTNEPALRLARKLVDATFAE---RVFLANSGAEANEAAFKLARRYANDVYGPQK 131 H SN+F LA+KLV+ + + F +NSGAEA E A KLAR + Sbjct: 72 IHCSNLFYVPHQGALAKKLVEISGLPGNAKAFFSNSGAEAMEGALKLARIRTG------R 125 Query: 132 YEIIAASNSFHGRTLFTVNVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAISDKTCAVV 191 E IA FHGRT+ ++ +P + F P + VPY D++ALK AI+++T AV+ Sbjct: 126 KEFIACEGGFHGRTMGSLACTHKPAIREPFMPLQPFTSFVPYGDVQALKGAITEETAAVI 185 Query: 192 LEPIQGEGGVLPAQQAYLEGARKLCDEHNALLVFDEVQSGMGRVGELFAYMHYGVVPDIL 251 LEPIQGEGGV+ YL+ R++CD LL+ DEVQSGMGR G FA+ G+ PDI+ Sbjct: 186 LEPIQGEGGVIIPPPGYLKQVREICDAKGVLLIVDEVQSGMGRTGHWFAFQEEGIHPDII 245 Query: 252 SSAKSLGGGFPIGAMLTTGEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGV 311 + AK++ GFP+GA++ + HG+T+ G P+A A A A++DVI +VL V Sbjct: 246 TMAKAMASGFPMGAIVAREGL--EFGKSEHGSTFAGGPIACAAALASIDVIG--KVLPEV 301 Query: 312 KAKHERFKSRLQKIGQEYGIFDEIRGMGLLIGAALTDEWKGKARDVLNAAEKEAVMVLQA 371 AK ERF++ L + R GL+IG + D DV ++V A Sbjct: 302 AAKGERFRAALAHLNP--------RVKGLMIGITIGDH----CADVQKECAVHGLLVNCA 349 Query: 372 SPDVVRFAPSLVIDDAEIDEGLERFERAVAK 402 + +R P L I +AEID+ AV+K Sbjct: 350 AHGNLRLVPPLTITNAEIDKATGIINAAVSK 380 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 384 Length adjustment: 31 Effective length of query: 375 Effective length of database: 353 Effective search space: 132375 Effective search space used: 132375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory