Align 5-aminovalerate transaminase (EC 2.6.1.48) (characterized)
to candidate WP_109969613.1 DK846_RS14130 acetylornithine transaminase
Query= BRENDA::Q88RB9 (425 letters) >NCBI__GCF_003173355.1:WP_109969613.1 Length = 384 Score = 215 bits (548), Expect = 2e-60 Identities = 147/407 (36%), Positives = 212/407 (52%), Gaps = 54/407 (13%) Query: 26 IFVDTAKNSTVIDVEGRELIDFAGGIAVLNTGHLHPKVVAAVQEQLTKVSHTCFQVLAYE 85 I + TV D +G++ +D GIAV +TGH HPKVV A+ EQ ++ H C + Sbjct: 23 IMITKGSGCTVTDADGKQYLDLVAGIAVCSTGHCHPKVVKAIAEQAAELIH-CSNLFYVP 81 Query: 86 PYVELCEKINKLVPGDFDKKTLLVTTGSEAVENAVKIARAATGRAGVIAFTGGYHGRTMM 145 L +K+ ++ + K +G+EA+E A+K+AR TGR IA GG+HGRTM Sbjct: 82 HQGALAKKLVEISGLPGNAKAFFSNSGAEAMEGALKLARIRTGRKEFIACEGGFHGRTMG 141 Query: 146 TLGLTGKVVPYSAGMGLMPGGIFRALFPSELHGISVDDAIASVERIFKNDAEPRDIAAII 205 +L T K M L P F + P V+ + A + AA+I Sbjct: 142 SLACTHKPAIREPFMPLQP---FTSFVP-----------YGDVQAL--KGAITEETAAVI 185 Query: 206 LEPVQGEGGFLPAPKELMKRLRALCDQHGILLIADEVQTGAGRTGTFFAMEQMGVAPDLT 265 LEP+QGEGG + P +K++R +CD G+LLI DEVQ+G GRTG +FA ++ G+ PD+ Sbjct: 186 LEPIQGEGGVIIPPPGYLKQVREICDAKGVLLIVDEVQSGMGRTGHWFAFQEEGIHPDII 245 Query: 266 TFAKSIAGGFPLAGVC-------GKAEYMDAIAPGGLGGTYAGSPIACAAALAVIEVFEE 318 T AK++A GFP+ + GK+E+ G T+AG PIACAAALA I+V Sbjct: 246 TMAKAMASGFPMGAIVAREGLEFGKSEH---------GSTFAGGPIACAAALASIDVI-- 294 Query: 319 EKLLDRSKAVGERLTAGLREIQKKYPIIGDVRGLGSMIAVEVFEKGTHTPNAAAVGQVVA 378 K+L A GER A L + + V+GL MI + + G H + V Sbjct: 295 GKVLPEVAAKGERFRAALAHLNPR------VKGL--MIGITI---GDHCAD-------VQ 336 Query: 379 KAREKGLILLSCGTYGNVLRILVPLTAEDALLDKGLAIIEECFAEIA 425 K +L++C +GN LR++ PLT +A +DK II ++ A Sbjct: 337 KECAVHGLLVNCAAHGN-LRLVPPLTITNAEIDKATGIINAAVSKFA 382 Lambda K H 0.320 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 458 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 384 Length adjustment: 31 Effective length of query: 394 Effective length of database: 353 Effective search space: 139082 Effective search space used: 139082 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory