Align 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase (EC 2.2.1.10) (characterized)
to candidate WP_109967236.1 DK846_RS01985 class I fructose-bisphosphate aldolase family protein
Query= BRENDA::Q57843 (273 letters) >NCBI__GCF_003173355.1:WP_109967236.1 Length = 264 Score = 303 bits (775), Expect = 3e-87 Identities = 155/261 (59%), Positives = 192/261 (73%), Gaps = 1/261 (0%) Query: 11 GKLVRLERIFNRESEKTVIVPMDHGVSNGPIKGLIDIRKTVNDVAEGGANAVLLHKGIVR 70 GK +RLERI NR + KT+IVPMDHGVS GPI+GLI+ VN VAEGGANAVL H G+ Sbjct: 3 GKDIRLERIMNRNTRKTIIVPMDHGVSLGPIEGLIEFPDAVNAVAEGGANAVLGHIGLSL 62 Query: 71 HGHRGYGKDVGLIIHLSGGTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVGSDEDWEA 130 GHR G DVGLI+HLS TAI P+P +KV+V +V AI+MGADAVSIHVN+G+D + + Sbjct: 63 FGHRQRGHDVGLIMHLSASTAIGPDPNEKVLVNSVTNAIKMGADAVSIHVNIGADSEAQM 122 Query: 131 YRDLGMIAETCEYWGMPLIAMMYPRGKHIQNERDPELVAHAARLGAELGADIVKTSYTGD 190 DLG ++ C WGMPL+AMMYPRGK+I++E E V AAR+ AELG DIVKT+YTGD Sbjct: 123 LADLGRVSIECMEWGMPLLAMMYPRGKNIKDEHAVEHVRLAARVAAELGVDIVKTNYTGD 182 Query: 191 IDSFRDVVKGCPAPVVVAGGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNIFQHDDVVGIT 250 D+FR+V +GCP PVVVAGG KT+ D L++I+ AME GAAG+++GRN FQH D Sbjct: 183 PDTFREVTRGCPVPVVVAGGSKTD-DIITLELIEGAMEGGAAGISIGRNAFQHPDPAQFV 241 Query: 251 RAVCKIVHENADVEEALKEIR 271 RA IVHE EAL+ ++ Sbjct: 242 RACALIVHEGKSAHEALEILK 262 Lambda K H 0.318 0.138 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 264 Length adjustment: 25 Effective length of query: 248 Effective length of database: 239 Effective search space: 59272 Effective search space used: 59272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory