Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate WP_109967812.1 DK846_RS04480 ABC transporter ATP-binding protein
Query= SwissProt::Q9F9B0 (260 letters) >NCBI__GCF_003173355.1:WP_109967812.1 Length = 295 Score = 101 bits (251), Expect = 2e-26 Identities = 64/222 (28%), Positives = 112/222 (50%), Gaps = 15/222 (6%) Query: 6 ILTARGLVKRYGRVTALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEGEIRL 65 ++ A L ++YG T L F G+IL +IG NGAGK++++K +SG + PD G + + Sbjct: 1 MINASHLSRKYGEATVLHDVSFTCEEGQILGIIGHNGAGKTTLLKILSGLIKPDSGSLTI 60 Query: 66 EGKPIQFRSPMEARQAGIETVYQNLALSPALSIADNMFLGREIRKPGIMGKWFRSLDRAA 125 G + PM+ + + + + L +++ D + EI LDR Sbjct: 61 GGVDV-LSDPMQVK-CQLGYLPEESRLYETMTVPDYLRFFGEI----------YGLDRET 108 Query: 126 MEKQARAKLSELGLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAALGVK 185 ++ +A L++L L + + LS G ++ VA+AR +++ DEP + L Sbjct: 109 VDSRAGILLAQLSL---NPDGKRIGNLSKGMKRKVAIARTLIHDPAILVYDEPGSGLDPM 165 Query: 186 ESRRVLELILDVRRRGLPIVLISHNMPHVFEVADRIHIHRLG 227 SR ++E + D+R RG I+L +HN+ V E+ D + I + G Sbjct: 166 TSRFIIEYLKDLRNRGKTIILSAHNLNQVEEICDLVMILKQG 207 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 295 Length adjustment: 25 Effective length of query: 235 Effective length of database: 270 Effective search space: 63450 Effective search space used: 63450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory