Align Putative UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_109968284.1 DK846_RS07420 SDR family oxidoreductase
Query= curated2:Q57664 (305 letters) >NCBI__GCF_003173355.1:WP_109968284.1 Length = 304 Score = 218 bits (554), Expect = 2e-61 Identities = 113/303 (37%), Positives = 192/303 (63%), Gaps = 7/303 (2%) Query: 3 LVTGGAGFIGSHIVDKLIENNYDVIILDNLTTGNKNNI-NPKAEFVNADIRDKDLDEKIN 61 ++TGGAGFIGSH+ K + +++V+++DNL +G +I + +F+ + D L +++ Sbjct: 4 VITGGAGFIGSHLA-KALAMDHEVVVIDNLFSGKMEHIVHTPVKFIQGSVTDFLLLKQV- 61 Query: 62 FKDVEVVIHQAAQINVRNSVENPVYDGDINVLGTINILEMMRKYDIDKIVFASSGGAVYG 121 F+ + + H+AA +V SV++P+ + N+ GT+N+L ++ ++ K+VFASS +VYG Sbjct: 62 FEGSDGIFHEAAITSVPRSVKDPLPTNETNITGTLNVLLAAKEMNVRKVVFASSS-SVYG 120 Query: 122 EPNYLPVDENHPINPLSPYGLSKYVGEEYIKLYNRLYGIEYAILRYSNVYGERQDPKGE- 180 + LP EN P NP+SPYG+SK+ GE+Y ++++ LYG++ LRY NV+G QDPK E Sbjct: 121 DTPVLPKTENMPPNPMSPYGISKFAGEQYCRVFSELYGLKTVSLRYFNVFGPCQDPKSEY 180 Query: 181 AGVISIFIDKMLKNQSPIIFGDGNQTRDFVYVGDVAKANLMALNWKNE-IVNIGTGKETS 239 + VI FI ++LK++SP+I+GDG QTRDF YV DV +AN+ A+ E + N+ ++ S Sbjct: 181 SAVIPKFITRILKHESPVIYGDGKQTRDFTYVKDVVQANIKAMESNIEGVFNVAYNQQIS 240 Query: 240 VNELFDIIKHEIGFRGEAIYDKPREGEVYRIYLDIKKAES-LGWKPEIDLKEGIKRVVNW 298 + L +I G I+++ R G++ DI + ++ +G+ P +K G+ + W Sbjct: 241 LISLASLIMELTGITAPIIFERERPGDIRDSLADISRIQNQIGYTPHYSVKSGLMETIAW 300 Query: 299 MKN 301 +N Sbjct: 301 YQN 303 Lambda K H 0.317 0.140 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 304 Length adjustment: 27 Effective length of query: 278 Effective length of database: 277 Effective search space: 77006 Effective search space used: 77006 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory