Align fumarate hydratase (EC 4.2.1.2); (S)-2-methylmalate dehydratase (EC 4.2.1.34) (characterized)
to candidate WP_109968318.1 DK846_RS07605 fumarate hydratase
Query= BRENDA::Q141Z6 (520 letters) >NCBI__GCF_003173355.1:WP_109968318.1 Length = 279 Score = 151 bits (382), Expect = 3e-41 Identities = 102/275 (37%), Positives = 150/275 (54%), Gaps = 25/275 (9%) Query: 27 ADSLQYISYYHPLDYIQALGRAYELEQSPAAKDAIAQILTNSRMCAEGKRPICQDTGIVT 86 A++++ P D ++ + A E E SP A+ + IL N R+ E + PICQDTGI Sbjct: 18 ANAIRIAEITLPPDVLERIVAASEDETSPVARRELMHILENIRLADERQAPICQDTGIPV 77 Query: 87 VFVKVGMDVRWDGATMGVTDMINEGVRRGYLNPDNVLRASIVSPPEGGRKNTKDNTPA-- 144 +++ + + + + D + +GVR + LR ++V P R NT NT A Sbjct: 78 IYLTLPPQIPFSSE---IVDAVRKGVREATVTIP--LRPNLVDPIT--RHNTGTNTSADM 130 Query: 145 -VIHYEIVPGNTVDVQVAAKGGGSENKSKFAMLNPS--DSIVDWILKTVPTMGAGWCPPG 201 +H I+PG+ + V V KG GSEN S+ M P+ D I ++I++T G CPP Sbjct: 131 PAVH--ILPGDRMQVTVLPKGAGSENVSRLKMFTPTEKDRIPEFIVETALLAGGRPCPPI 188 Query: 202 MLGIGIGGTAEKAMVMAKESLMDPIDIQDVIARGPKDWIEELRVELHEKVNALGIGAQGL 261 +LG+GIGGT + A +AKE+L++P+D P++ +E+ +KVN LGIG GL Sbjct: 189 ILGVGIGGTFDGAASLAKEALLEPLDQMT-----PEE------MEICQKVNDLGIGPMGL 237 Query: 262 GGLATVLDVKIMAAPTHAASKPVAIIPNCAATRHA 296 GG T L VKI +A H AS PVA+ C A R A Sbjct: 238 GGKTTCLGVKIKSAGCHTASLPVAVNIQCWAARRA 272 Lambda K H 0.316 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 520 Length of database: 279 Length adjustment: 30 Effective length of query: 490 Effective length of database: 249 Effective search space: 122010 Effective search space used: 122010 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory