Align ABC transporter for L-Histidine, permease component 1 (characterized)
to candidate WP_109969962.1 DK846_RS15735 amino acid ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2554 (222 letters) >NCBI__GCF_003173355.1:WP_109969962.1 Length = 225 Score = 155 bits (393), Expect = 4e-43 Identities = 81/208 (38%), Positives = 138/208 (66%), Gaps = 2/208 (0%) Query: 13 PQLLAGALVTVEITAASLLLGCVMGLLVGIGRLNPKRRVVYALCTAYVAAIRGTPLLVQL 72 P LL+G +TV + A +LL+G ++GL + +G++ K ++ ++ + YV RG P+LV L Sbjct: 12 PYLLSGIFITVGLVAVALLIGIILGLPMALGQVYGKH-LIRSVISIYVWFFRGLPVLVLL 70 Query: 73 FILFFGL-PQFGILLPAFVCGVIGLGIYSGAYVSEVVRGAIQSIDKGQMEAARSIGMSSG 131 F+ +FG+ P G+ LPAFV G + LG+ AY S++ RGAIQSI +GQM AARS+GMS Sbjct: 71 FLFYFGIFPGLGLDLPAFVVGAVVLGLRGAAYQSQIFRGAIQSIAEGQMTAARSLGMSRA 130 Query: 132 LAMRTVVLPQAVVRMIPPLGNEFIALIKNSALVSLLTIHDLMHEGQKIISVSYRSLEVYL 191 A+R+++LPQA+ +P NE+ ++ S++ + + +L+ +I+S +Y ++ +YL Sbjct: 131 QAIRSIILPQAMRIALPGWSNEYPEILTESSICYAIGVAELLTRSSQIVSQTYVTMPIYL 190 Query: 192 AIAVVYFILTGATTLVLRRIELRLRAGG 219 A AV++ +L+ A T +++R+E R+ G Sbjct: 191 ACAVMFILLSYAGTHLIQRLEKRIAIPG 218 Lambda K H 0.328 0.143 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 225 Length adjustment: 22 Effective length of query: 200 Effective length of database: 203 Effective search space: 40600 Effective search space used: 40600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory