Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_109970082.1 DK846_RS16450 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >NCBI__GCF_003173355.1:WP_109970082.1 Length = 251 Score = 165 bits (417), Expect = 1e-45 Identities = 86/210 (40%), Positives = 131/210 (62%), Gaps = 3/210 (1%) Query: 22 QALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSGRVLLDGAPVEGPGAERGM 81 +A+ + +R + V ++GPSGCGKST+LRI++ L+HA SG++ G V M Sbjct: 22 RAIDSLSLTIRKKEIVCLMGPSGCGKSTVLRIISKLEHADSGQIH-GGDGVFSEQLRSAM 80 Query: 82 VFQSYTLFPWLTIEQNIRFGL--RERGMPEAQQKERAAYFIAKVGLRGFEQHFPKQLSGG 139 VFQ + LFPWL++ +NI +GL + R + Q ++ + V + F P QLSGG Sbjct: 81 VFQEHGLFPWLSVRENIAYGLNMKVRFSSKEQVNQKVTELLTLVRMEEFANSHPHQLSGG 140 Query: 140 MQQRTAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIWEAERKTVLFVTHDIDEA 199 M+QR A+ARALA +P+ILLMDEPF ALD TR +Q+ +L I T VTH+ +EA Sbjct: 141 MKQRVAVARALAVEPEILLMDEPFSALDPFTRRELQDEVLRIRNQLNTTFFIVTHNPEEA 200 Query: 200 IFMANRVAVFSARPGRIKTELAVDLPHPRH 229 +++++R+ + + RP ++ E+ V LP PR+ Sbjct: 201 VYLSDRIVILTHRPAVVRKEIPVSLPFPRN 230 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 251 Length adjustment: 24 Effective length of query: 235 Effective length of database: 227 Effective search space: 53345 Effective search space used: 53345 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory