Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_109969948.1 DK846_RS15740 amino acid ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_003173355.1:WP_109969948.1 Length = 250 Score = 117 bits (293), Expect = 2e-31 Identities = 73/254 (28%), Positives = 130/254 (51%), Gaps = 17/254 (6%) Query: 6 NEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGT 65 +E +LKV I K FG + L V +K+G+ IGP+G GK+T I L PD+G Sbjct: 4 SEFILKVEDIRKSFGSSEVLKGVSFNVKKGETICFIGPSGTGKSTLLRCINQLTIPDSGK 63 Query: 66 FELAGKPYEPTAVH-EVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRT 124 L G+ + + I FQN LF +TA+ NV + A+ + Sbjct: 64 VLLNGEEVTHSGSQINHFRQKIGMVFQNFFLFDHLTAVRNVEI------------ALLKV 111 Query: 125 KGFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEP 184 KG A++A +A + L VG+ ++AD+ LS G +R+ IARALA DP ++ DEP Sbjct: 112 KGMNAKDARA--KAMKELQQVGMAEWADHFPAELSGGQAQRVSIARALAMDPDVMLFDEP 169 Query: 185 AAGMNATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEV 244 + ++ ++ E++ ++ D T+L++ H++ + +++ +++G +G+P + Sbjct: 170 TSALDPELTREVLEVMKKLALDGMTMLVVTHEMGFACSVANQILFMEHGVIKEQGSPQVL 229 Query: 245 QKNEKV--IEAYLG 256 + K +A++G Sbjct: 230 LNDPKFERCKAFIG 243 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 250 Length adjustment: 24 Effective length of query: 236 Effective length of database: 226 Effective search space: 53336 Effective search space used: 53336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory