Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_109968951.1 DK846_RS10730 ABC transporter ATP-binding protein
Query= TCDB::P73650 (240 letters) >NCBI__GCF_003173355.1:WP_109968951.1 Length = 250 Score = 105 bits (261), Expect = 1e-27 Identities = 65/197 (32%), Positives = 109/197 (55%), Gaps = 10/197 (5%) Query: 24 INFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEIIFKGENITGLGSDQIV----- 78 I+ ++ PGE++ ++G NG+GKST+ + GLL P GEI+ G + + Q + Sbjct: 17 IDLTVNPGEVLILLGTNGSGKSTVLNLLSGLLEPDDGEIVLNGHVV--FNAKQKIFSPPE 74 Query: 79 RRGMCYVPQVCNVFGSLTVAENLDMGAFLHQGPTQTLKDRIYTMFPKL--AQRRNQRAGT 136 R + YV Q +F ++V +N+ G + + P + + +I L A RN+R Sbjct: 75 ERNIGYVFQNYALFPHMSVFDNIAYGLKMRKIPKEQIVSQIQRTLEDLEIAHVRNERVTN 134 Query: 137 LSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQIK-AINATGKAIILVEQN 195 LSGG+RQ +A+ RAL++ P LLLLDEP AL P+ + + +++ + + I+V + Sbjct: 135 LSGGQRQRVALARALIVQPHLLLLDEPLTALDPMAREKIRLELREQLVTSSHPAIMVTHS 194 Query: 196 AKQALMMADRGYVLENG 212 K A ++ DR +LE G Sbjct: 195 IKDAQIIGDRVIILEKG 211 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 117 Number of extensions: 3 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 250 Length adjustment: 24 Effective length of query: 216 Effective length of database: 226 Effective search space: 48816 Effective search space used: 48816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory