Align 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 (characterized)
to candidate WP_109969430.1 DK846_RS13185 aspartate aminotransferase family protein
Query= SwissProt::P22256 (426 letters) >NCBI__GCF_003173355.1:WP_109969430.1 Length = 400 Score = 207 bits (528), Expect = 4e-58 Identities = 133/395 (33%), Positives = 206/395 (52%), Gaps = 31/395 (7%) Query: 28 DRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFQVLAYEPYL 87 ++ + VWD G++YLDF G V GH +P + A+ Q KK+ Y P Sbjct: 27 EKGDGVYVWDENGKQYLDFTSGWGVTCIGHANPIITEALCNQSKKIIQNPNSGATYSPAR 86 Query: 88 E-LCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAATKRSGTIAFSGAYHGRTHYTL 146 L ++ ++ +P + +G+EA + A+K+AR T + I+ ++HGRT T+ Sbjct: 87 SRLIQLFHEILPKHLTR-IFFANSGAEANDAAIKLARKVTGKKNIISTEMSFHGRTISTV 145 Query: 147 ALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISEDDAIASIHRIFKNDAAPEDIAAIVIE 206 + TG+ + LMPG+ + P + IS I +D+AA+++E Sbjct: 146 SATGQDVHRNKFNPLMPGYFF-----VPFNDISAVKEIID-----------QDVAAVIVE 189 Query: 207 PVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTF 266 P+QGEGG S +++ L +C EHG++ IADE+Q+G RTG LF G PD+ T Sbjct: 190 PIQGEGGVNIPSESYLLELSEVCREHGVLFIADEIQTGFFRTGPLFYSISKGAKPDIITM 249 Query: 267 AKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAGNPIACVAALEVLKVFEQENLLQKAND 326 AK IAGGFP + EV++ + G GGTY GNP+ C + V++ ++ +D Sbjct: 250 AKGIAGGFPFSAFAVTDEVVNGIQKGDHGGTYNGNPLGCAVSEAVIRYLIDSDIESHVSD 309 Query: 327 LGQKLKDGLLAIAEKHPE-IGDVRGLGAMIAIELFEDGDHNKPDAKLTAEIVARARDKGL 385 LG L EK+P+ I +VRG G +IA+EL +D +AEIV R D GL Sbjct: 310 LGIDTIKRLNGWKEKYPKAITEVRGQGLLIALELTDD--------LKSAEIVTRCLDNGL 361 Query: 386 IL-LSCGPYYNVLRILVPLTIEDAQIRQGLEIISQ 419 IL L G +++RI LTI +++ GL+I+ + Sbjct: 362 ILNLKHG---HIIRIFPALTITKQEMQTGLDILEK 393 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 400 Length adjustment: 31 Effective length of query: 395 Effective length of database: 369 Effective search space: 145755 Effective search space used: 145755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory