Align spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized)
to candidate WP_109970082.1 DK846_RS16450 ABC transporter ATP-binding protein
Query= CharProtDB::CH_024626 (378 letters) >NCBI__GCF_003173355.1:WP_109970082.1 Length = 251 Score = 159 bits (402), Expect = 8e-44 Identities = 87/191 (45%), Positives = 127/191 (66%), Gaps = 6/191 (3%) Query: 33 IPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGRIMLDNEDITHVPAENRYVN 92 I L LTI E + L+GPSGCGK+TVLR+I+ LE DSG+I + V +E Sbjct: 24 IDSLSLTIRKKEIVCLMGPSGCGKSTVLRIISKLEHADSGQIHGGDG----VFSEQLRSA 79 Query: 93 TVFQSYALFPHMTVFENVAFGLRMQK--TPAAEITPRVMEALRMVQLETFAQRKPHQLSG 150 VFQ + LFP ++V EN+A+GL M+ + ++ +V E L +V++E FA PHQLSG Sbjct: 80 MVFQEHGLFPWLSVRENIAYGLNMKVRFSSKEQVNQKVTELLTLVRMEEFANSHPHQLSG 139 Query: 151 GQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQRKLGITFVFVTHDQEE 210 G +QRVA+ARA+ +P +LL+DE SALD R+++Q+E+ ++ +L TF VTH+ EE Sbjct: 140 GMKQRVAVARALAVEPEILLMDEPFSALDPFTRRELQDEVLRIRNQLNTTFFIVTHNPEE 199 Query: 211 ALTMSDRIVVM 221 A+ +SDRIV++ Sbjct: 200 AVYLSDRIVIL 210 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 251 Length adjustment: 27 Effective length of query: 351 Effective length of database: 224 Effective search space: 78624 Effective search space used: 78624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory