Align 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase (EC 2.2.1.10) (characterized)
to candidate WP_109967235.1 DK846_RS01980 class I fructose-bisphosphate aldolase family protein
Query= BRENDA::Q57843 (273 letters) >NCBI__GCF_003173355.1:WP_109967235.1 Length = 257 Score = 270 bits (689), Expect = 3e-77 Identities = 130/257 (50%), Positives = 186/257 (72%), Gaps = 3/257 (1%) Query: 10 LGKLVRLERIFNRESEKTVIVPMDHGVSNGPIKGLIDIRKTVNDVAEGGANAVLLHKGIV 69 +GK +R+ERI +R + K+VI+PMDHG++ G I GL+++ +T+ V++GGANA++LHKG+V Sbjct: 2 IGKQIRMERIMDRNTGKSVIIPMDHGMTLGQIDGLLNMSETIGAVSDGGANAIILHKGLV 61 Query: 70 RHGHRGYGKDVGLIIHLSGGTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVGSDEDWE 129 + GHR +G+D+GLIIHLS GT+++P+P KVI TVEEAI +GADAVSIH+N+G+ ++ + Sbjct: 62 KAGHRRHGRDIGLIIHLSTGTSMNPDPNDKVITCTVEEAISLGADAVSIHINLGAQQESK 121 Query: 130 AYRDLGMIAETCEYWGMPLIAMMYPRGKHIQNERDPELVAHAARLGAELGADIVKTSYTG 189 D G++ C WG+PL+AM+YPRGK I N DP V HA R+ ELGAD+VKT+YTG Sbjct: 122 MIEDAGIVVRDCNRWGIPLLAMVYPRGKGI-NPTDPRHVGHAVRVAEELGADMVKTNYTG 180 Query: 190 DIDSFRDVVKGCPAPVVVAGGPKTNTDEEFLQMIKDAME-AGAAGVAVGRNIFQHDDVVG 248 D+++F+ +V+ PV +AGG K D E L++I +A A AGV +GRN FQ +D Sbjct: 181 DVENFKKIVEASSIPVFIAGGEKAG-DLETLKIISEATHIANCAGVCMGRNAFQREDTAI 239 Query: 249 ITRAVCKIVHENADVEE 265 VCK+VH A E+ Sbjct: 240 FVDKVCKVVHGKAKPED 256 Lambda K H 0.318 0.138 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 257 Length adjustment: 25 Effective length of query: 248 Effective length of database: 232 Effective search space: 57536 Effective search space used: 57536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory